KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0809Help
Entry
DvMF_0809         CDS       T00816                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DvMF_0809
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DvMF_0809
Exosome [BR:dvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DvMF_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(975417..976910)
Genome map
AA seq 497 aa AA seqDB search
MTKYVLALDQGTTSSRAILFSREGDIIQISQKEFTQIYPQPGWVEHNANEIFDTESWGMR
DCLKQAGIDGSQVVAAGITNQRETTVVWDKASGAPVYNAIVWQDRRTAGFCDELKARGLA
DTFRQKTGLVLDAYFSGTKVRWILENVPGARAKAEKGELLFGTIDTWLIWNLTKGKVHAT
DESNASRTLLFNINTGQWDDELLGILGVPRSMLPTVTRSSEVVGEIHPEFLGKAIPIAGN
AGDQQAATYGNACLKPGMAKNTYGTGCFMLMNTGKEVHASKNNLLTTMAWATPSGRYFAL
EGSVFIAGAVVQWLRDGLGIIKDAPEVEQLALSVPDNGGVYLVPAFAGLGAPHWDQYARG
TMVGITRGSTKAHIARAALESIALQTLDIMDCMQKDAGIKLAALRADGGATRNNLLMQFQ
ADVLGVPVERPKVTETTALGAAYLAGLAVGFWKSEEEIEAMWQLDRRFEPNMSAETREKL
VYDWQRAVERAKAWAQE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtacgttctcgcacttgaccagggcaccaccagttctcgcgccatcctcttc
tcgcgcgaaggagacatcatccagatttcccagaaggaattcacccagatctacccgcag
ccgggctgggtggaacataacgccaacgagatcttcgacaccgaatcgtggggcatgcgc
gactgcctgaagcaggcgggcattgatggttctcaggtggtggccgcgggcatcaccaac
cagcgcgaaaccacggtggtctgggacaaggccagcggcgcgccggtgtacaacgccatc
gtgtggcaggaccgccgcacggcgggcttctgcgacgaactgaaggcgcgcggcctggcc
gacaccttccgccagaagaccggccttgtgcttgacgcctacttctccggcaccaaggtg
cgctggatccttgaaaacgtgcccggcgcccgcgccaaggccgaaaagggcgaactgctg
ttcggcaccatcgacacctggctcatctggaacctgaccaagggcaaggtgcacgccacc
gacgaatccaacgccagccgtaccctgctgttcaacatcaacaccggccagtgggacgac
gaactgctgggcattctgggcgtgccgcgctccatgctgcccacggtgacccgctcgtcc
gaagtggtgggcgagatccatccggagttcctgggcaaggccattcccattgctggcaac
gcgggcgaccagcaggccgccacctacggcaacgcctgcctgaagccgggcatggccaag
aacacctacggcaccggctgcttcatgctcatgaacaccggcaaggaagtgcacgccagc
aagaacaacctgctgaccaccatggcctgggccacgccttcggggcgctacttcgccctt
gaaggcagcgtattcatcgccggtgcggtggtgcagtggctgcgcgacggccttggcatc
atcaaggacgcccccgaggtggaacagctggccctgagcgtgccggacaacggcggcgtg
tacctggtgcccgccttcgctggccttggcgcgccgcattgggaccagtacgcgcgcggt
accatggtgggcatcacccgcggctccaccaaggcccacatcgcccgcgcggccctggaa
tccatcgccctgcaaaccctggacatcatggattgcatgcagaaggacgcgggcatcaag
ctggcggccctgcgcgccgacggtggcgccacccgcaacaacctgctgatgcagttccag
gccgacgtgctgggcgtgccggtggaacgtcccaaggtgacggaaaccacggcgctgggc
gcggcctatctggccggtctggccgtgggcttctggaagagcgaagaggaaatcgaggcc
atgtggcagcttgaccgccgcttcgaacccaacatgtccgctgaaacccgcgaaaagctg
gtgtacgactggcagcgggcggttgaacgggccaaggcctgggcgcaagaatag

DBGET integrated database retrieval system