KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0840Help
Entry
DvMF_0840         CDS       T00816                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DvMF_0840
Enzymes [BR:dvm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DvMF_0840
Exosome [BR:dvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DvMF_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1014472..1016403)
Genome map
AA seq 643 aa AA seqDB search
MQLTYPAFIEPFDLYMFGKGEHWDLYRVLGAHPVAQDGAEGYRVAVWAPSAREVYLVGDF
NDWRWGEYPLYPVGVSGVWAAFVPGMRKGALYKFGIRTGEAGDGRIVYKTDPFALYAEMR
PGVAAVAWDIDNHQWADGDWMQCRAEAGPPLRQAVSIYEVHAGSWQRKTDGTGVGGHPFL
SWDELGDGLIPHVQNLGFTHIELLPVAEHPLDQSWGYQTGHYYAPTSRHGTPEDFKRFVD
RCHQAGIGVILDWVPAHFPKDDWSLGRFDGTALYEHLDPRRGEHPDWGTFIFNYGRHEVR
NFLLANALYWLREFHIDGLRMDAVASMLYLDYSREGGDWLPNDHGGRENLDAVEFLRQLN
VVVHGQFPGAMTIAEESTAWAGVSRPVYTGGLGFTFKWNMGWMHDTLNYFRHEPVHRAYH
HNALTFSLLYAFTENFVLPLSHDEVVHGKGALLSKMPGDAWQQQASLRALYAYMWAHPGK
KLLFMGGEFGQWNEWDESGALDWCLYQFPAHGGIHALLRDLNSILRREPAMHAHDHDWTG
FRWMDFSDWGGSVISFVRQCPDGEGAPPVLWVFNFTPVVREYYRVPAPRGGTWRVVLNTD
SEYYGGSNVGNGGALQARTDEWGGGHHLVLTLPPLAGLALMPG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttacctaccccgccttcatcgagcccttcgacctgtacatgttcggcaagggc
gaacactgggacctttaccgggtgctcggcgcgcatcccgtggcgcaggacggagcggaa
ggctaccgggtggccgtgtgggcgccctctgcccgcgaggtgtatctggtgggcgatttc
aacgactggcgctggggcgaatatccgctgtacccggtgggcgtttccggcgtgtgggcg
gccttcgtgcccggcatgcgcaagggcgcgctgtacaagttcggcatccgcaccggggag
gcgggcgacgggcgcatcgtctacaagaccgacccctttgccctgtacgccgaaatgcgt
cccggcgtggcggcagtggcctgggacatagacaatcaccagtgggccgacggcgactgg
atgcagtgccgcgccgaggcggggccgccgctgcggcaggccgtgtccatctacgaggtg
cacgcgggctcgtggcagcgcaagaccgatggcacgggcgtgggcggccaccccttcctg
tcgtgggacgaactgggcgacgggctgatcccgcacgtgcagaacctgggcttcacgcac
atcgagctgctgcccgtggcggaacatccgctggaccagtcgtggggctaccagaccggg
cactactatgcccccacgtcgcgccacggaacgccggaagacttcaagcgcttcgtggac
cgctgccatcaggcgggcataggggtcattctcgattgggtgcccgcgcactttcccaag
gacgactggagccttggccgcttcgacggcacggccctgtacgagcatctggacccgcgc
cggggcgaacacccggactggggcaccttcatcttcaactacggtcggcatgaggtgcgc
aacttcctgctggccaacgccctgtactggctgcgcgaattccacatcgacggcctgcgc
atggatgccgtggcctccatgctctacctcgactactcgcgcgagggcggcgactggctg
cccaacgaccatggcgggcgcgaaaacctggacgccgtggaattcctgcgccagctcaac
gtggtggtgcacgggcagttccccggggccatgaccatagccgaggaatccacggcctgg
gccggggtttcgcgcccggtgtacaccggcggcctcggcttcaccttcaagtggaacatg
ggctggatgcacgacacgctgaactacttccggcacgagccggtgcaccgcgcctaccac
cacaacgcgctgaccttttcgctgttgtacgccttcaccgagaatttcgtgctgccgctc
tcgcacgacgaggtggtgcacggcaagggcgcgctgctgtccaagatgcccggcgacgcg
tggcaacagcaggccagcctgcgcgcgctgtacgcctacatgtgggcgcatccgggaaag
aagctgctgttcatgggcggcgaattcggccagtggaacgaatgggacgaaagcggcgcg
ctggactggtgcctgtaccagttcccggcgcacgggggcatccacgccctgctgcgcgac
ctgaactccatcctgcggcgcgaaccggccatgcacgcgcacgaccacgactggacgggc
tttcgctggatggacttttccgactggggcggctcggtgatcagcttcgtgcgccagtgc
ccggacggggagggcgccccgcccgtgctgtgggtgttcaacttcaccccggtggtgcgc
gaatactaccgggtgcccgcgcccaggggcggcacctggcgcgtggtgctgaacaccgac
agcgaatactacggcggctccaacgtgggcaacggcggcgcattgcaggcccgcaccgac
gagtggggcggcgggcaccatcttgtgctcaccctgccgccgctggcggggttggccctg
atgccggggtag

DBGET integrated database retrieval system