KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_0900Help
Entry
DvMF_0900         CDS       T00816                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DvMF_0900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_0900
   00052 Galactose metabolism
    DvMF_0900
   00500 Starch and sucrose metabolism
    DvMF_0900
   00520 Amino sugar and nucleotide sugar metabolism
    DvMF_0900
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DvMF_0900
   00524 Butirosin and neomycin biosynthesis
    DvMF_0900
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DvMF_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1084479..1085576)
Genome map
AA seq 365 aa AA seqDB search
MRVLAADIGGTNSRFALYEAGGLARGHVPRPQDRLCAVRLPTAGTASFADLLRRAAAEEP
GLFTSPALLVLAVAGPVRGGRRCTPPNIPWAVDLDEPALRAPGMPPLPPVLLINDFVAQA
YACLRPAAPDGPVAPVAPVAPDGPDEPDGPVVPDMLNMLDVLDGHPVPDAPIAVVGAGTG
LGKCLLLPASGDGMPPRVLPSEGGHALFPFTDEREMAFAAFVRAHTGRQVIGDLVVSGPG
LRLLHAFHTGQWLEPAEVAARLATGAPGADSDLALPQVLSWFARFYGRACRDYVLETLAL
GGVFISGGVAAATPALVTHPAFAEAFRQSDTHADLLRAVPVRLVRSPDAGLLGAALYGAL
NRPAH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctggcggcggacataggcggcaccaacagccgctttgccctgtacgaggcg
ggcgggctggcgcgcggccacgtgccgcgcccgcaggaccgtctgtgcgcggtgcgcctg
cccacggcgggtacggcgtcctttgccgatctgctgcgccgtgccgctgccgaagagccg
gggttgttcacgtccccggcgctgctggtgctggccgtggccggaccggtgcgtggcggg
cggcgttgcaccccgcccaacatcccctgggcggtggatctggacgaaccggcgttgcga
gcgccgggcatgccgcccctgcctccggtactgctgatcaacgatttcgtggcccaggcc
tacgcctgcctgcgcccggcggcgccggatgggccggttgcgccggttgcgccggttgcg
ccggatgggccggacgagccggacgggccagtggtgccggacatgctgaacatgctggac
gtgctggacgggcatcccgtgccggacgctcccattgccgtggtgggcgcgggcacgggc
cttggcaagtgcctgctgctgcccgcgtccggtgacggcatgccgccccgcgtcctgccc
tccgaaggagggcacgccctgttccccttcacggacgagcgggagatggcctttgccgcg
ttcgtgcgtgcccacaccgggcggcaggtcatcggcgacctggtggtgtccggtcccggc
ctgcgcctgctgcacgcctttcacaccgggcagtggctggagcccgccgaggtggcggcc
cgcctggccaccggagcgccaggggccgattccgacctcgccctgcctcaagtcttgtca
tggttcgcccgcttctatggccgagcctgccgtgattacgtgctggaaaccctggctctg
gggggggtgttcatctccggcggggtggcggcggccacgcccgcactggtgacgcacccg
gcctttgccgaagcctttcgccaaagcgatacccatgccgacctgctgcgcgcggtaccc
gtgcgtctggtgcgcagtcccgacgccgggctgctgggcgcggccctgtatggcgccctg
aatcggccagcccactga

DBGET integrated database retrieval system