KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1019Help
Entry
DvMF_1019         CDS       T00816                                 

Definition
peptidase dimerisation domain-containing protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dvm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1235111..1236346
Genome map
AA seq 411 aa AA seqDB search
MSQSTDTFARFAEQARACLPSGLDEATASDIADMVALTARLMAIRSTASRPEELARCADV
IAAWLADNNIPCTRMEHEGVPSLTAGNPAHAAPLALLVHFDVVDGADVMFAPRLDLTEGV
LHGRGSIDDKYAVALALVLCRRCLRELAARGLGPDALPLVLVITGDEETGGRNGAFRVLP
HIRADFCVALDGGSPGSVITKEKGVIDLVLTARGKSAHGARPWLGENAVDALVRDYEALK
PLFPGLYPERAGLAAPDAPPPSAVLPQAEAHWHRTLNLGLLHAGTAVNQVPGEAVAHLDV
RYTEHDNPHQLVAAMRAAVRGELAVTRMEPLFVTGDTPWLDRLLRHAPGAATGCAHGASD
ARFLTDLSMAGVVWGAEGETSQHTDHEHLLIPSLVPVYQALLALARDAANG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatccacagacaccttcgcccgattcgcggagcaggcccgcgcctgcctgccc
tccgggctggacgaggctaccgcctcggacatcgccgacatggtggcgctgaccgcccgg
ctcatggccatccgctccacggcctcgcgcccggaagaactggcccgctgcgccgacgtc
atcgccgcctggctggccgacaacaacattccctgcacccgcatggagcacgagggcgtg
ccatcccttacggcgggcaacccggcccacgccgcgccgctggccttgctggtgcacttc
gacgtggtggacggcgcggacgtcatgttcgcaccgcgcctggacctgacggagggcgtg
ctgcacgggcgcggcagcatcgacgacaagtacgccgtggcgctggccctggtgctgtgc
cgccgctgcctgcgcgagcttgcggcacggggccttggcccggatgccctgcccctggtg
ctggtgatcaccggcgacgaggaaaccggcggtcgcaatggcgccttccgcgtgctgccg
cacatccgcgccgacttctgcgtggcgctggacggcggttcgccgggctcggtcatcaca
aaggaaaaaggggtcatcgacctggtgctcacggcgcggggcaaaagcgcccacggcgcc
cggccctggctgggcgaaaacgccgtggatgcgctggtgcgcgactacgaggccctgaag
cccctctttcccggcctgtatccggaacgggcggggctggcagcgcctgatgcgccgccc
ccctccgccgtgttgccgcaggcggaggcccactggcaccgcaccctcaacctgggcctg
ctgcacgcgggcacggcggtgaaccaggtacccggcgaagccgtggcccatctggacgtg
cgctacacggagcacgacaacccccaccaactggtggccgccatgcgtgccgccgtgcga
ggcgaactggccgtcacccgcatggagccgctgttcgtcaccggcgacaccccgtggctg
gacaggctgttgcgccacgcccccggcgcggccaccggctgcgcccacggggccagcgat
gcccggttcctgaccgatctttccatggccggggtggtctggggcgcggaaggcgaaacc
agtcagcacaccgaccacgaacacctgctgatccccagcctggtgccggtgtaccaggcc
ctgctggccctggcgcgcgatgcggccaacggatag

DBGET integrated database retrieval system