KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1019Help
Entry
DvMF_1019         CDS       T00816                                 

Definition
(GenBank) peptidase dimerisation domain protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00300  Lysine biosynthesis
dvm01100  Metabolic pathways
dvm01120  Microbial metabolism in diverse environments
dvm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    DvMF_1019
Enzymes [BR:dvm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DvMF_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACL07974
UniProt: B8DPR7
Position
1235111..1236346
Genome map
AA seq 411 aa AA seqDB search
MSQSTDTFARFAEQARACLPSGLDEATASDIADMVALTARLMAIRSTASRPEELARCADV
IAAWLADNNIPCTRMEHEGVPSLTAGNPAHAAPLALLVHFDVVDGADVMFAPRLDLTEGV
LHGRGSIDDKYAVALALVLCRRCLRELAARGLGPDALPLVLVITGDEETGGRNGAFRVLP
HIRADFCVALDGGSPGSVITKEKGVIDLVLTARGKSAHGARPWLGENAVDALVRDYEALK
PLFPGLYPERAGLAAPDAPPPSAVLPQAEAHWHRTLNLGLLHAGTAVNQVPGEAVAHLDV
RYTEHDNPHQLVAAMRAAVRGELAVTRMEPLFVTGDTPWLDRLLRHAPGAATGCAHGASD
ARFLTDLSMAGVVWGAEGETSQHTDHEHLLIPSLVPVYQALLALARDAANG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatccacagacaccttcgcccgattcgcggagcaggcccgcgcctgcctgccc
tccgggctggacgaggctaccgcctcggacatcgccgacatggtggcgctgaccgcccgg
ctcatggccatccgctccacggcctcgcgcccggaagaactggcccgctgcgccgacgtc
atcgccgcctggctggccgacaacaacattccctgcacccgcatggagcacgagggcgtg
ccatcccttacggcgggcaacccggcccacgccgcgccgctggccttgctggtgcacttc
gacgtggtggacggcgcggacgtcatgttcgcaccgcgcctggacctgacggagggcgtg
ctgcacgggcgcggcagcatcgacgacaagtacgccgtggcgctggccctggtgctgtgc
cgccgctgcctgcgcgagcttgcggcacggggccttggcccggatgccctgcccctggtg
ctggtgatcaccggcgacgaggaaaccggcggtcgcaatggcgccttccgcgtgctgccg
cacatccgcgccgacttctgcgtggcgctggacggcggttcgccgggctcggtcatcaca
aaggaaaaaggggtcatcgacctggtgctcacggcgcggggcaaaagcgcccacggcgcc
cggccctggctgggcgaaaacgccgtggatgcgctggtgcgcgactacgaggccctgaag
cccctctttcccggcctgtatccggaacgggcggggctggcagcgcctgatgcgccgccc
ccctccgccgtgttgccgcaggcggaggcccactggcaccgcaccctcaacctgggcctg
ctgcacgcgggcacggcggtgaaccaggtacccggcgaagccgtggcccatctggacgtg
cgctacacggagcacgacaacccccaccaactggtggccgccatgcgtgccgccgtgcga
ggcgaactggccgtcacccgcatggagccgctgttcgtcaccggcgacaccccgtggctg
gacaggctgttgcgccacgcccccggcgcggccaccggctgcgcccacggggccagcgat
gcccggttcctgaccgatctttccatggccggggtggtctggggcgcggaaggcgaaacc
agtcagcacaccgaccacgaacacctgctgatccccagcctggtgccggtgtaccaggcc
ctgctggccctggcgcgcgatgcggccaacggatag

DBGET integrated database retrieval system