KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1138Help
Entry
DvMF_1138         CDS       T00816                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00230  Purine metabolism
dvm01100  Metabolic pathways
Module
dvm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DvMF_1138
Enzymes [BR:dvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DvMF_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 MobB AAA_18 MMR_HSR1 AAA_25 AAA Thymidylate_kin AAA_16 RsgA_GTPase AAA_35 RNA_helicase IstB_IS21 TsaE AAA_19 AAA_24
Motif
Other DBs
NCBI-ProteinID: ACL08092
UniProt: B8DKD0
Position
complement(1396370..1396999)
Genome map
AA seq 209 aa AA seqDB search
MARQRSGIVLVLCAPSGTGKTTLTKRLLAEFSRFAYSISYTTRQPRTGEVNGRDYHFVTV
AEFTRLRDEGFFAEWAEVHGNFYGTPLQATLDMLRDGRDVIFDIDVQGASQLRGSLRQGC
YVFILPPSRAELERRLRARGTDDEPTIQRRLANAAKELDQAHWFNAWIVNEDLETAYDEL
RAAYIAATLSPSCSPDLVGGLMEGWREGR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccaacgatccggcatcgtgctcgtgctgtgcgccccctcgggcaccggcaag
accaccctgaccaaacgcctgctcgcggaattttcccgctttgcctactccatttcctac
accacccgccagccgcgcacgggcgaggtgaacggccgcgactaccacttcgtcacggtg
gccgaattcacccgcctgcgtgacgaaggcttcttcgccgaatgggcggaggtgcacggc
aacttctacggcaccccgctgcaagccaccctggacatgctgcgcgacgggcgcgacgtg
atcttcgacatcgacgtgcagggcgcaagccagttgcgcggcagcctgcgccaggggtgc
tacgtgttcatcctgccgccctcgcgggcggagctggagcgccgcctgcgcgcgcgcggc
accgacgacgagcccaccatccagcgccgcctggccaatgccgccaaggaactggaccag
gcccactggttcaacgcctggatcgtcaacgaagacctggaaaccgcctacgacgaactg
cgggccgcgtacatcgcggccacgctgtcgccctcgtgcagccccgacctcgtggggggg
ctgatggaggggtggcgggaaggacggtga

DBGET integrated database retrieval system