KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1425Help
Entry
DvMF_1425         CDS       T00816                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dvm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dvm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1742627..1743604
Genome map
AA seq 325 aa AA seqDB search
MQHAQRPTWPHKDLLDVTQLTRAELFHLLDTAAQFHDINRRPVKKVPTLKGKSVVLFFAE
PSTRTKTSFDVAGKRLSADTFSLAKSGSSLSKGESLKDTALTLQAMTPDIIVIRHSSSGA
AQFLAERLDCSVVNAGDGWHAHPTQALLDCYSLRQVWGDTFEGRTLLILGDIAHSRVARS
NVHLLSSLGVKVRLCAPRTLLPAGVHNWPVTIFNRLDDAVQGVDAVMCLRLQLERQQAGL
LPDLREYAQRFCLSPRHLTMAAPSARVLHPGPMNRGLEISSVLADAPESLILDQVAAGVA
TRMAILFLLATRTGIEQTADNGGRA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgcacaacgccccacgtggccccacaaggacctgctggacgtcacccagctg
acgcgggcagagctgttccacctgctggacacggcggcccagttccacgacatcaaccgc
cgccccgtgaaaaaggtgcccaccctgaagggcaagagcgtggtgctgttcttcgcggag
ccgagcacccgcaccaagacatcgttcgacgtggcgggcaagcggctttccgccgacacc
ttctcgctggccaagagcgggtccagcctgtccaagggcgaaagcctaaaggacaccgcc
ctgaccctgcaggccatgacgccggacatcatcgtcatccgccattcgtccagcggcgcg
gcgcagtttctggccgagcgactggactgctcggtggtcaacgcgggcgacggctggcac
gcccaccccacccaggccctgctggactgctattcgctgcgccaggtctggggcgatacc
ttcgaggggcgcaccctgctcatcctgggtgacattgcccacagccgggtggcccgctcc
aacgtgcacctgctctcgtcgctgggggtaaaggtgcggctgtgcgcgccgcgcaccctg
ctgcccgccggggtgcacaactggccggtgaccatcttcaaccggctggacgacgccgtg
cagggagtggacgcggtgatgtgcctgcgcctgcaactggaacgccagcaggcgggcctg
ctgcccgacctgcgcgaatacgcgcagcgtttctgcctgtcgccccggcacctgaccatg
gccgcgccgagcgcgcgggtactgcaccccggccccatgaaccgtgggctggaaatctcg
tccgtgctggccgacgcgcccgaaagcctgatcctggaccaggtggctgcgggcgtggcc
acgcgcatggcaatccttttcctgctcgccacccgcaccggcatagagcagaccgccgac
aacggaggccgcgcatga

DBGET integrated database retrieval system