KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1462Help
Entry
DvMF_1462         CDS       T00816                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DvMF_1462 (gpmA)
   01230 Biosynthesis of amino acids
    DvMF_1462 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_1462 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DvMF_1462 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DvMF_1462 (gpmA)
Enzymes [BR:dvm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DvMF_1462 (gpmA)
Exosome [BR:dvm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DvMF_1462 (gpmA)
  Exosomal proteins of melanoma cells
   DvMF_1462 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1792258..1793007
Genome map
AA seq 249 aa AA seqDB search
MHTLVLLRHGQSAWNLENRFTGWTDVDLSPEGEQEARDAARLLTDEGLTFDVCHTSVLTR
AIRTLYIVQHEMGLSWLPVHKHWRLNERHYGGLQGLDKAETAARFGEEQVFEWRRSYDTP
PPPLPADDPRSPAGDARYAGLAPDVLPASESLKETVARVLPYWHDVIAPQVLAGQRVLVA
AHGNSLRALVMHLDGMTPEAVTKLNIPTGLPLVYTLDGTLRPLAHRYLGDPAVAEAKAKA
VAAQGAARK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgctggtacttctgcgtcacgggcaaagcgcgtggaacctggaaaaccgcttc
accggctggaccgacgtggacctttcgcccgagggcgagcaggaggcgcgcgacgccgcc
cgcctgctgacggacgagggactgaccttcgacgtctgccatacctcggtgctcacccgg
gccatccgcaccctgtacatcgtgcagcacgaaatggggctgtcctggctgccggtgcac
aagcactggcggctcaacgaacgccactacggcggcctgcaagggctggacaaggcggaa
accgccgcccgcttcggcgaggaacaggtgttcgaatggcggcgcagctatgacaccccg
cccccgcccctgccagccgacgatccgcgcagccccgccggggatgcccgctacgcgggc
cttgcgcccgacgtgctgcccgccagcgaaagcctgaaggaaaccgtggcccgcgtgctg
ccctactggcacgacgtcatcgcgccgcaggtgctggccggacagcgggtgctggtggcg
gcccacggcaacagcctgcgcgccctggtcatgcatctggacggcatgaccccggaggcc
gtcaccaagctgaacatccccaccgggctgccgctggtctacaccctggacggcacgctg
cgtccgttggcccaccgctaccttggcgatcctgccgtggccgaggccaaggcaaaggcc
gtggcggcgcagggcgcggcgcgcaaatag

DBGET integrated database retrieval system