KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1705Help
Entry
DvMF_1705         CDS       T00816                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dvm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2081060..2082598
Genome map
AA seq 512 aa AA seqDB search
MTRPVRASGILLHITSLPSAFGIGDMGPAAHAFARLLAGAGQTVWQFLPLAPTSTFIGNS
PYSSPSAFAGNTLLISPERLAEEGFVSWADVDAGAEQFREAAHESGGPHGSGRPVRFEAV
EAHRRVLLRAAWERNRHQLAMDTAYLRFCRGNAHWLDDYARFTVLKERFGGTAWTTWDEP
FARRHPDALALLDVQEAAALDHVRFCQYLFFRQWYDLRAACTDLGVRLVGDVPIYVTHDS
ADVWANPGYFRLDADFAPTHVAGVPPDYFSATGQRWGNPVYDWDALRRDGFAWWVRRVAH
NLRMADIVRLDHFRGFAGYWEIPAAEETAINGRWVDAPGMELFGTLARRFTALPLIAEDL
GVITADVRELKATFGLPGMKVLQFGFGGDPADNPDVPFRHEVRSVVYTGTHDNAPTRAWF
EAAPAHERARVEEYVGHAIAPHEAPGVLLRLAMGSVAELAVAPVQDVLGLGAEARMNTPS
VAAGNWAWRMTPEQMDPGLYAELARLTRLFGR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaccggttcgcgccagcggcatcctgctgcacatcacctcgctgccctcggcc
ttcggcatcggcgacatgggaccggcggcgcacgccttcgcgcggctgctggccggggcc
gggcagacggtgtggcagttcctgccccttgcgcccacctccacgttcatcggcaattcg
ccctattccagcccctcggccttcgcgggcaataccctgctcatcagccccgaacggctg
gccgaagaaggctttgtctcgtgggcagacgtggacgccggggcggaacagttccgcgag
gcggcgcatgaatcgggtggaccacacggttctggccgcccggtccggttcgaggccgtg
gaggcccaccgccgcgtcctgttgcgcgccgcgtgggaacgcaaccgccaccagttggcc
atggacaccgcctacctgcgcttctgccggggcaacgcccactggctggacgactacgcc
cggttcacggtgctgaaggaacgcttcggcgggacggcctggaccacttgggacgaaccc
ttcgcccgccgccacccggacgctctggccctgctggacgtacaggaggccgccgcgctg
gaccacgtgcgcttctgccagtacctgttcttccgccagtggtacgacctgcgggccgcc
tgcaccgaccttggcgtgcggctggtgggcgacgtgcccatctacgtcacccacgacagc
gccgacgtgtgggccaaccccggctatttccggttggacgcggatttcgcccccacccac
gtggccggggtgccgccggactatttcagcgccacgggccagcgctggggcaacccggtg
tacgactgggacgccctgcggcgcgacggctttgcctggtgggtgcgccgcgtggcgcac
aacctgcgcatggccgacatcgtgcggctggaccacttccggggttttgccgggtactgg
gaaattccggcggcggaagaaacggccatcaatggccgctgggtggatgcgccgggcatg
gaactgttcggcacgctggcccggcggttcacggcgctgccgctcattgccgaggacctg
ggcgtgataaccgccgacgtgcgcgagctgaaggcgaccttcggcctgccgggcatgaag
gtgttgcagttcggctttggcggcgaccccgccgacaaccccgatgtccccttccggcac
gaggtgcgtagcgtggtctacaccggcacacacgacaacgcgcccacgcgggcatggttc
gaggcggccccggcgcacgaacgggcgcgggtggaagaatacgtgggccacgccattgcc
ccgcacgaggcccccggcgtgctgctgcgcctggccatgggcagcgtggccgaactggcc
gtggccccggtgcaggacgtgctgggcctgggggcggaagcgcgcatgaacacgccgtct
gtggcggcgggcaactgggcctggcggatgacgccggaacagatggaccccggactgtac
gcggaactggcgcggctgacgcgcctcttcggcaggtag

DBGET integrated database retrieval system