KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1743Help
Entry
DvMF_1743         CDS       T00816                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
dvm01130  Biosynthesis of antibiotics
dvm01230  Biosynthesis of amino acids
Module
dvm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DvMF_1743
Enzymes [BR:dvm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DvMF_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACL08688
UniProt: B8DM44
Position
complement(2130232..2131197)
Genome map
AA seq 321 aa AA seqDB search
MLDRFRIAKQPELDRLRKLAEAGGMPAPLASGTGGGTPRPDFLRALRDRTGYPDAPVAVI
AEYKRASPSRGVIETGVSPEDAATAYATAGATAISVLTEEQYFGGDLTYLGRMAGVNPDV
PLLRKDFIMDSLQVAATAATPAAALLLIVRLTPDAHTLRDLREQAETHGMHAVVEIFDEA
DLALARESGARIIQVNNRDLETLAVDRTACLRLGPLRAPGEVWIAASGISENRHLAEAAA
AGYDAALVGTALMDGGDLKGSLMRLLGREGTPSFRPPASSGCAACSGHVRSEYAPCASGS
PSLPENENPVVPDCSETEGAQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcgtttccgcatcgccaagcagccggaactggaccggctgcgcaagctggcc
gaggcgggcgggatgcccgcgccgctggcgtccgggacaggtggcggcacaccgcgcccc
gacttcctgcgggcgctgcgggaccgcaccggctaccccgatgcgccggtggcggtcatc
gcggagtacaagcgcgcctcgccctcgcgcggggtcatcgagacgggcgtgtcgcccgag
gacgcggcaacggcttacgccaccgccggggccacggccatctcggtgctgaccgaggag
cagtacttcggcggcgacctgacctatctggggcgcatggccggggtgaatcctgatgtt
cccctgttgcgcaaggacttcatcatggactcgttgcaggtggcggccacggcggccacc
ccggcggcggcgctgctgctgatcgtgcggctgacgcccgatgcgcacaccctgcgcgac
ctgcgcgagcaggccgaaacgcacggcatgcacgccgtggtggagatattcgacgaggct
gatctggcgctggcgcgtgaatccggcgcacggatcattcaggtgaacaaccgcgatctg
gaaacccttgccgtggaccgcaccgcctgcctgcgcctggggccgttgcgcgcccccggc
gaggtgtggatagcggccagcggcatcagcgagaaccgccatctggcggaagccgccgct
gccgggtatgacgcggcattggtgggcactgcgctcatggatggcggcgacctcaaaggc
tcactgatgcgtcttctggggcgcgagggcactccgtcctttcgccctccggcgtcgtca
ggctgcgccgcctgctccggtcacgtacggtcggagtacgctccctgcgcgtcgggctcg
ccttccttgccggagaacgaaaatcctgtcgtgccagattgcagcgaaaccgaaggtgcg
caatga

DBGET integrated database retrieval system