KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1743Help
Entry
DvMF_1743         CDS       T00816                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvm01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dvm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2130232..2131197)
Genome map
AA seq 321 aa AA seqDB search
MLDRFRIAKQPELDRLRKLAEAGGMPAPLASGTGGGTPRPDFLRALRDRTGYPDAPVAVI
AEYKRASPSRGVIETGVSPEDAATAYATAGATAISVLTEEQYFGGDLTYLGRMAGVNPDV
PLLRKDFIMDSLQVAATAATPAAALLLIVRLTPDAHTLRDLREQAETHGMHAVVEIFDEA
DLALARESGARIIQVNNRDLETLAVDRTACLRLGPLRAPGEVWIAASGISENRHLAEAAA
AGYDAALVGTALMDGGDLKGSLMRLLGREGTPSFRPPASSGCAACSGHVRSEYAPCASGS
PSLPENENPVVPDCSETEGAQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcgtttccgcatcgccaagcagccggaactggaccggctgcgcaagctggcc
gaggcgggcgggatgcccgcgccgctggcgtccgggacaggtggcggcacaccgcgcccc
gacttcctgcgggcgctgcgggaccgcaccggctaccccgatgcgccggtggcggtcatc
gcggagtacaagcgcgcctcgccctcgcgcggggtcatcgagacgggcgtgtcgcccgag
gacgcggcaacggcttacgccaccgccggggccacggccatctcggtgctgaccgaggag
cagtacttcggcggcgacctgacctatctggggcgcatggccggggtgaatcctgatgtt
cccctgttgcgcaaggacttcatcatggactcgttgcaggtggcggccacggcggccacc
ccggcggcggcgctgctgctgatcgtgcggctgacgcccgatgcgcacaccctgcgcgac
ctgcgcgagcaggccgaaacgcacggcatgcacgccgtggtggagatattcgacgaggct
gatctggcgctggcgcgtgaatccggcgcacggatcattcaggtgaacaaccgcgatctg
gaaacccttgccgtggaccgcaccgcctgcctgcgcctggggccgttgcgcgcccccggc
gaggtgtggatagcggccagcggcatcagcgagaaccgccatctggcggaagccgccgct
gccgggtatgacgcggcattggtgggcactgcgctcatggatggcggcgacctcaaaggc
tcactgatgcgtcttctggggcgcgagggcactccgtcctttcgccctccggcgtcgtca
ggctgcgccgcctgctccggtcacgtacggtcggagtacgctccctgcgcgtcgggctcg
ccttccttgccggagaacgaaaatcctgtcgtgccagattgcagcgaaaccgaaggtgcg
caatga

DBGET integrated database retrieval system