KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1945Help
Entry
DvMF_1945         CDS       T00816                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DvMF_1945
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DvMF_1945
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DvMF_1945
Enzymes [BR:dvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DvMF_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2402038..2403516
Genome map
AA seq 492 aa AA seqDB search
MPCPTSCPAPGHDFPTARTRMEYVCLGCGERRGIDELLYTCPSCGGVYLLEDLDFDTLAE
QRTGPEWRALFDARAATRTTALRGIFRFYELMAPVLEEEDIVYLGEGNTPIVEAAPVLRD
AVGIPFAFKNDGQNPSASFKDRGMACAFSYLKALVRKHGWDEVLTVCASTGDTSAAAALY
ASYVGGPVKSVVLLPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALL
NSKNSWRILGQESYAFEVAQWYGWDMKGQCVFVPIGNAGNVTAIMAGFLKLLRLGVIDAL
PRVIGVQSHHADPVWRYYSQPDPATRTYAPVTVQPSVAQAAMIGNPVSFPRVKALADRFI
AEGGERAFSVVQVTEQEIMDAMIRGNRHGHIACTQGGECLAGLIKARELGLVSQGEHAVL
DATAHSLKFAGFQDMYFTNSFPPEYGVTPDASLANAPALVVSPEDKARLSPEAYTLAAAK
AVVARLGLAKKA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtcccacatcctgtcccgcacccggtcacgactttccgaccgcgcgcacgcgg
atggagtacgtctgccttggctgcggagagcgtcgcggcatcgacgaactgctgtacacc
tgccccagctgcggcggggtgtacctgcttgaagaccttgatttcgacacgctggcggaa
cagcgcaccggtcccgaatggcgcgccctgttcgacgcccgcgccgccacccgcaccacc
gccctgcgcggcatcttccgcttctacgagctgatggccccggtgctggaagaagaggac
atcgtgtaccttggcgagggcaacacccccatcgtcgaggcggctcccgtgctgcgcgat
gccgtgggcattcccttcgccttcaagaacgacgggcagaaccccagcgcctcgttcaag
gaccggggcatggcctgcgcgttcagctacctgaaggcgctggtgcgcaagcacggctgg
gacgaggtgctgaccgtgtgcgcctccaccggcgacacttccgccgccgccgcgctgtac
gcctcgtacgtgggcgggccggtgaagtcggtggtgctgctgccgcacggcaaggtcacc
ccgcagcagctttcgcagcccctcggcagcggggccacggtgctggaaattcccggcgtg
ttcgacgattgcatgaaggtggtggaacacctggccgaaaactaccgggtggccctgctg
aattccaagaacagctggcgcatcctgggccaggaatcgtacgccttcgaggtggcccag
tggtacggctgggacatgaaggggcagtgcgtgttcgtgcccatcggcaacgcgggcaac
gtcacggccatcatggcaggcttcctgaagctgctgcgccttggcgtcatcgacgccctg
ccgcgggtcatcggcgtgcagtcgcaccatgcggacccggtgtggcgctactacagccag
ccggacccggccacccgcacctacgccccggtcaccgtgcagcccagcgtggcccaggcg
gccatgatcggcaacccggtgtccttcccgcgcgtgaaggcgctggcggacaggttcatc
gcggaagggggcgaacgcgccttctccgtggtgcaggtgaccgagcaggagatcatggac
gccatgatccggggcaaccgccacgggcacatcgcctgcacccagggcggtgaatgcctg
gccggcctcatcaaggcacgggaactgggcctggtgtcgcagggcgagcacgccgtgctc
gacgccacggcgcacagcctgaagtttgcgggcttccaggacatgtacttcaccaacagc
ttcccgcccgaatacggcgtgaccccggacgccagcctggccaacgcgcccgcgctggtg
gtcagcccggaagacaaggcgcgcctgtcgcccgaggcctacacccttgccgccgccaag
gcggtggtggccaggctggggctggcgaagaaggcgtaa

DBGET integrated database retrieval system