KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_1965Help
Entry
DvMF_1965         CDS       T00816                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DvMF_1965
Enzymes [BR:dvm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     DvMF_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2427647..2428804)
Genome map
AA seq 385 aa AA seqDB search
MDTTLRPIGVIVSPLTDLSQCPKQGDEGAPEAWVEIAAPYVPGLDTLTPGLSLTLLTWLH
RADRHVLSVHPRGDTRRPRRGVFNTRSPARPNPVGLHEVRLLELAPGTDGGVRLRVAPLE
ALDGTPVIDIKTSYRQRQPDPASGDGLDGVGADRSGNTFRMAEASADSNANGNASVHVVS
GSAPSPWGEGIPEGYADELRRICLRGWQRGLYSGFNGNASLRMGTACLLTCSGAAKGDLG
PGDLALVDIASGAVLAGGKPSSEGAMHLAIYRARPDAMAVVHTHPPRLLALGALVPPDDM
LRLPIYESELLRGQLGFAPAHAPGTQELADAVAAAAVTRDAVWMERHGLCCAGPSAARAL
ALAEELEHLARVQLAVLSAHAKVRD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaccctgcggcccatcggcgtcatcgtgtcgccgctcacggatctttcgcag
tgccccaagcagggcgacgaaggcgcgcccgaagcgtgggtggagattgccgcgccctac
gtgcccggcctggacaccctgacgccgggcctgtccctgaccctgctcacctggctgcac
cgcgccgatcgccatgtgctgtccgtgcacccgcgcggcgacacgcgccgccccagacgc
ggcgtgttcaacacccgctcgcccgcccggcccaacccggtgggcctgcacgaggtgcgc
ctgctggaactggcccccggcacggacggcggcgtgcgcctgcgcgtggccccgctggag
gcgctggacggcacgccggtcatcgacatcaagacctcgtaccgccagcgccagccggac
ccggcgtccggggacggcttggacggggtcggcgcagatcgcagtggtaatacatttcgt
atggcggaagcgagcgcggatagtaatgcgaatggcaatgcatccgtgcacgtcgtctcc
ggctccgccccctcgccgtggggagaaggcatccccgaaggctacgccgacgaattgcgg
cgcatctgcctgcgcggctggcagcgcggcctgtattccgggttcaacggcaacgccagc
ctgcgcatgggcacggcctgtctgctgacctgctccggtgcggccaagggcgatcttggc
cccggcgacctcgcgctggtggacattgcctccggcgcggtgctggccgggggcaagccc
tcgtctgaaggggccatgcatctggccatctatcgtgcccggcccgacgccatggccgtg
gtgcacacccatccgccgcgcctgctggcccttggcgcgcttgtcccgccggacgacatg
ctgcgcctgcccatctacgaatcggagctgctgcgggggcaactgggctttgcgcccgct
cacgcccccggcacgcaggaactggccgacgccgtggccgctgccgccgtcacccgcgac
gcggtgtggatggaacgccacggcctgtgttgcgccgggccttccgccgcccgtgccctg
gccctggccgaggagctggagcatctggccagggtgcagctggccgtgctgtccgcccac
gccaaggtgcgggactga

DBGET integrated database retrieval system