KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2027Help
Entry
DvMF_2027         CDS       T00816                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DvMF_2027
Enzymes [BR:dvm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DvMF_2027
Transfer RNA biogenesis [BR:dvm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DvMF_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2512017..2512979)
Genome map
AA seq 320 aa AA seqDB search
MIDPAGKAEGSPAATSVARSSAASFPLRDLLPLVMEAGRAILHWCGGAAPRIRRKADDSP
VTEADEASQAVLAHGLARLRPDLPVLSEEGRIPPHAERAGWPRFLLVDPLDGTRGFLNGE
GDFAVCLALVEHGFPTAGILHFPALGVTWFGGRGCGAWRLEHDAPPEPVHAARTFPQRAT
VMQGRVRRTPRLDAFLAAHADICSAAFPGRPGAPAPVPLPSDTAAQDRLRAGLFPHRRMQ
AGGPLKFCLVAEGAAHVFPCMHPTWEWDTAPGQALLEGAGGMVTLLDGRPLAYNKPDLRN
ECILAVGPAVCAPNTCAADT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccccgcaggcaaggccgaggggtctcccgccgcaacctccgtcgctcggtcc
tccgccgcatcctttcccctgcgcgacctgctgcccctcgtgatggaggcgggccgggcc
atcctgcactggtgcggcggcgccgccccgcgcatccgccgcaaggccgacgattctccg
gtcaccgaggcggacgaggcctcgcaggccgtgctggcccacgggctggcccgcctgcgg
ccggacctgcccgtgctgtccgaggaagggcgcattcccccgcacgccgagcgcgcgggc
tggccgcgctttctgctggtggacccgctggacggcacgcgcggctttctgaacggcgaa
ggggactttgcggtgtgcttggccctggtggaacacggtttccccacggcgggcatcctg
cactttcccgcgctgggggtgacttggttcggcgggcgtggctgcggcgcgtggcgactg
gagcacgacgccccgccggaaccggtgcacgcggcgcgcacgtttccgcaacgggccacg
gtgatgcaggggcgggtgcgccgcaccccccggctggacgcctttctggccgcccatgcg
gatatctgttcggcggcgtttccggggcgtcccggcgcgcccgcgcccgtgcccctgccg
tccgacacggcggcacaggacaggctgcgcgccgggctgtttccgcaccggcgcatgcag
gcgggcgggccgctgaaattctgtctggtggcggagggggcggcgcacgtctttccgtgc
atgcaccccacctgggaatgggataccgcgccgggacaggcgctgctggaaggggcgggc
ggcatggtcacgctgctggacggcaggccgctggcctacaacaagcccgacttgcgcaac
gaatgcattctggccgtgggccctgccgtctgcgccccaaacacgtgcgctgcggacaca
tga

DBGET integrated database retrieval system