KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2027Help
Entry
DvMF_2027         CDS       T00816                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dvm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2512017..2512979)
Genome map
AA seq 320 aa AA seqDB search
MIDPAGKAEGSPAATSVARSSAASFPLRDLLPLVMEAGRAILHWCGGAAPRIRRKADDSP
VTEADEASQAVLAHGLARLRPDLPVLSEEGRIPPHAERAGWPRFLLVDPLDGTRGFLNGE
GDFAVCLALVEHGFPTAGILHFPALGVTWFGGRGCGAWRLEHDAPPEPVHAARTFPQRAT
VMQGRVRRTPRLDAFLAAHADICSAAFPGRPGAPAPVPLPSDTAAQDRLRAGLFPHRRMQ
AGGPLKFCLVAEGAAHVFPCMHPTWEWDTAPGQALLEGAGGMVTLLDGRPLAYNKPDLRN
ECILAVGPAVCAPNTCAADT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccccgcaggcaaggccgaggggtctcccgccgcaacctccgtcgctcggtcc
tccgccgcatcctttcccctgcgcgacctgctgcccctcgtgatggaggcgggccgggcc
atcctgcactggtgcggcggcgccgccccgcgcatccgccgcaaggccgacgattctccg
gtcaccgaggcggacgaggcctcgcaggccgtgctggcccacgggctggcccgcctgcgg
ccggacctgcccgtgctgtccgaggaagggcgcattcccccgcacgccgagcgcgcgggc
tggccgcgctttctgctggtggacccgctggacggcacgcgcggctttctgaacggcgaa
ggggactttgcggtgtgcttggccctggtggaacacggtttccccacggcgggcatcctg
cactttcccgcgctgggggtgacttggttcggcgggcgtggctgcggcgcgtggcgactg
gagcacgacgccccgccggaaccggtgcacgcggcgcgcacgtttccgcaacgggccacg
gtgatgcaggggcgggtgcgccgcaccccccggctggacgcctttctggccgcccatgcg
gatatctgttcggcggcgtttccggggcgtcccggcgcgcccgcgcccgtgcccctgccg
tccgacacggcggcacaggacaggctgcgcgccgggctgtttccgcaccggcgcatgcag
gcgggcgggccgctgaaattctgtctggtggcggagggggcggcgcacgtctttccgtgc
atgcaccccacctgggaatgggataccgcgccgggacaggcgctgctggaaggggcgggc
ggcatggtcacgctgctggacggcaggccgctggcctacaacaagcccgacttgcgcaac
gaatgcattctggccgtgggccctgccgtctgcgccccaaacacgtgcgctgcggacaca
tga

DBGET integrated database retrieval system