KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2183Help
Entry
DvMF_2183         CDS       T00816                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00620  Pyruvate metabolism
dvm00630  Glyoxylate and dicarboxylate metabolism
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
dvm01120  Microbial metabolism in diverse environments
dvm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DvMF_2183
   00630 Glyoxylate and dicarboxylate metabolism
    DvMF_2183
Enzymes [BR:dvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DvMF_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACL09126
UniProt: B8DQK7
Position
2723923..2726118
Genome map
AA seq 731 aa AA seqDB search
MTQRVQVGGLQIAAPLYDVIVRDIAPGTGVDPDRFWTALENMVETMADRNRALLAKRAEL
QDAIDAWHRERRGTPHDGAAYEAFLRSIGYLVPEGPDFAVTTEGVDPEIALVAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDVIPEDPARGGAPRGGAYNPARGALVVARAAAFLD
EAFPLATGSHADAARYDVRGGKLAVILKDGAETGLADPARFVGHAGDPAGGNGAVLLRNH
GLHAEIRIDREHAIGRGHAAGVRDVVMEAAMTTILDCEDSVAVVDGADKALAYRNMLGLF
RGDLSAEFPKGGRSVLRTLNPDREYTGPDGAAFSLPGRSLLLVRTVGHLMTTDAVLARSG
EEIPEGMLDTMATAYIALHDLRGTSSVRNSRTGGVYIVKPKQHGPEEVAFTVELFRMAED
ALGMPRNTLKIGIMDEERRTTVNLKECIRAAAERVIFINTGFLDRTGDEIHTCMEAGPVV
RKNAMRGERWIIAYEDWNVDTGLACGLAGRAQVGKGMWAKPDMMREMVETKIGHPRAGAN
CAWVPSPTAATLHAMHYHAVDVAAVQKTLAGQRRATLADLLTLPLMGPASRPTPQEVEEE
LANNAQSILGYVVRWVEQGIGCSKVPDITDVGLMEDRATLRISSQHIANWLHHGICTRDQ
VVAVLKRMAAVVDRQNAGDPAYRPMSADFDASVAFQAACDLVLLGREQPSGYTEPILHAR
RQEAKAKFGII
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgtgttcaggtgggtggcttgcagatcgcagcgccgctgtatgacgtcatt
gtccgcgacatcgcgccgggtaccggcgtggaccccgaccggttctggacggcccttgag
aacatggtggaaaccatggccgacaggaaccgcgccctgctggcgaaacgggcggaattg
caggatgccatcgacgcctggcaccgcgaacggcggggcacgccgcacgatggcgccgcc
tacgaggcctttctgcgctccatcggctacctggtgcccgaagggccggactttgccgtg
accaccgaaggcgtggacccggaaatcgccctggtggccggaccgcagctggtggtgccg
atcaccaacgcccgctatgccctgaatgccgccaatgcccgctggggcagcctgtacgac
gccctgtacggcaccgacgtgattcccgaagacccggcccggggaggcgcgccgcgcggc
ggcgcctacaaccccgcgcgcggggcgctggtggtggcgcgggccgccgcctttctggac
gaggcctttccgctggccaccggcagccacgccgatgcggcgcgctacgacgtgcgtggc
ggcaagctggcggtcatcctgaaggacggcgcggaaacgggccttgccgaccccgcccgc
ttcgtcgggcatgcgggtgatcccgccgggggcaacggcgcggtgctgctgcgcaatcac
ggcctgcacgcggaaatccgcatcgaccgcgaacacgccatcggcaggggccatgccgcc
ggggtgcgcgacgtggtgatggaagcggccatgaccaccatcctcgattgcgaggattcg
gtggccgtggtggacggcgcggacaaggcgctggcctaccgcaacatgctgggcctgttc
cggggcgacctttcggcggaatttcccaagggcggacgcagcgtgctgcgcaccctgaac
ccggatcgcgaatacaccgggccggacggggccgcgttctcgctgccgggccgcagcctg
ctgctggtgcgcaccgtgggccacctgatgaccaccgacgcggtgctcgcccggtccggc
gaagaaattcccgaaggcatgctggacaccatggccacggcctacatcgccctgcacgac
ctgcgcggcacctccagcgtgcgcaacagccgcaccggcggggtgtacatcgtcaagccc
aagcagcacgggccggaagaggtggcctttaccgtcgagctgttccgcatggcggaagac
gccctgggcatgccgcgcaacacgctgaagatcggcatcatggacgaggagcgccgcacc
acggtgaacctgaaggaatgcatccgtgcggcggcggagcgggtcatcttcatcaacacc
ggcttcctggaccgcaccggcgacgaaatccacacctgcatggaggcgggcccggtggtg
cgcaagaacgccatgcgcggcgaacgctggatcatcgcctacgaggactggaacgtggac
acgggccttgcctgcggccttgccgggcgcgcccaggtgggcaagggcatgtgggccaag
cccgacatgatgcgcgagatggtggaaaccaagatcggccaccccagggcgggcgccaat
tgcgcgtgggtgccctcgcccaccgcagccaccctgcacgccatgcactatcacgccgtg
gacgtggccgccgtgcagaagaccctggcgggccagcgccgcgccaccctggccgacctg
ctgaccctgcccctgatggggcccgcatcccgccccacgccgcaagaggtggaagaggag
cttgccaacaacgcccagtccatcctgggctatgtggtgcgctgggtggaacagggcatc
ggctgctccaaggtgccggacatcaccgacgtggggctgatggaagaccgcgccaccctg
cgcatttccagccagcacatcgccaactggctgcaccacggcatctgcacccgcgatcag
gtggtggcggtgctcaagcgcatggccgccgtggtggatcgccagaacgcgggcgacccg
gcctaccggcccatgagcgccgactttgacgccagcgtggccttccaggccgcgtgcgac
cttgtgctgctggggcgcgagcagccctcgggctacacggagcccatcctgcatgcccgc
aggcaggaggcgaaggcgaagttcggcatcatctag

DBGET integrated database retrieval system