KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2271Help
Entry
DvMF_2271         CDS       T00816                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DvMF_2271
DNA repair and recombination proteins [BR:dvm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DvMF_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2853744..2854349
Genome map
AA seq 201 aa AA seqDB search
MQRLPEPLKALVEQLSRLPGLGPKSALRLAMTLLKWPASETRRLGRAVHDLRDNLHLCGR
CGALTDVDPCGICTDPARSGETLCLVSEWDSLLTLEEGGFYKGQYLILGGLLAPLDNLHA
DSLELDRLTKRMAEGTVREVVMALGTTVEAENTATYIRNMIVRQYPQVRVTRLAQGIPLG
SEVKFMDRETLRQSMQYRQDL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgactgcccgaaccgttgaaggcgctggtggagcagctctcccggctgcccggc
cttggccccaagtcggccctgcgtcttgccatgaccctgctgaagtggcccgccagcgaa
acccgcaggctgggccgcgccgtgcatgacctgcgcgacaacctgcatctgtgcgggcgc
tgcggcgcgctgacagacgtggacccctgcggcatctgcaccgacccggcccgcagcggc
gaaacgctgtgtctggtgtcggaatgggattccctgctcaccctggaagagggcggcttc
tacaagggccagtacctcatccttggcggcctgctggccccgctggacaacctgcacgcc
gattcgctggaactggaccggctgaccaaaaggatggccgaaggcacggtgcgcgaggtg
gtcatggcccttggcaccaccgtggaggcggaaaacaccgccacctacatccgcaacatg
atcgtccggcagtacccgcaggtgcgcgtgacccggctggcccagggcattccgctgggg
tccgaggtcaagttcatggatagggagacgctcaggcagtcgatgcagtaccgccaagac
ctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system