KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2271Help
Entry
DvMF_2271         CDS       T00816                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DvMF_2271
DNA repair and recombination proteins [BR:dvm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     DvMF_2271
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DvMF_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 HHH HHH_8 HHH_5
Motif
Other DBs
NCBI-ProteinID: ACL09214
UniProt: B8DQU5
Position
2853744..2854349
Genome map
AA seq 201 aa AA seqDB search
MQRLPEPLKALVEQLSRLPGLGPKSALRLAMTLLKWPASETRRLGRAVHDLRDNLHLCGR
CGALTDVDPCGICTDPARSGETLCLVSEWDSLLTLEEGGFYKGQYLILGGLLAPLDNLHA
DSLELDRLTKRMAEGTVREVVMALGTTVEAENTATYIRNMIVRQYPQVRVTRLAQGIPLG
SEVKFMDRETLRQSMQYRQDL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgactgcccgaaccgttgaaggcgctggtggagcagctctcccggctgcccggc
cttggccccaagtcggccctgcgtcttgccatgaccctgctgaagtggcccgccagcgaa
acccgcaggctgggccgcgccgtgcatgacctgcgcgacaacctgcatctgtgcgggcgc
tgcggcgcgctgacagacgtggacccctgcggcatctgcaccgacccggcccgcagcggc
gaaacgctgtgtctggtgtcggaatgggattccctgctcaccctggaagagggcggcttc
tacaagggccagtacctcatccttggcggcctgctggccccgctggacaacctgcacgcc
gattcgctggaactggaccggctgaccaaaaggatggccgaaggcacggtgcgcgaggtg
gtcatggcccttggcaccaccgtggaggcggaaaacaccgccacctacatccgcaacatg
atcgtccggcagtacccgcaggtgcgcgtgacccggctggcccagggcattccgctgggg
tccgaggtcaagttcatggatagggagacgctcaggcagtcgatgcagtaccgccaagac
ctctag

DBGET integrated database retrieval system