KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2322Help
Entry
DvMF_2322         CDS       T00816                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DvMF_2322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_2322
   00620 Pyruvate metabolism
    DvMF_2322
   00650 Butanoate metabolism
    DvMF_2322
  Lipid metabolism
   00071 Fatty acid degradation
    DvMF_2322
  Amino acid metabolism
   00350 Tyrosine metabolism
    DvMF_2322
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DvMF_2322
   00626 Naphthalene degradation
    DvMF_2322
Enzymes [BR:dvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DvMF_2322
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     DvMF_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2921623..2924337)
Genome map
AA seq 904 aa AA seqDB search
MSKKPNAQGAKPATTPDAISLNDISPSSIAPNSITVDDIVTRVNEAQRAFANFTQQQVDA
IFHAAAAAATAQRIHLARMAVQETGMGILEDKVIKNHFASEYIYNKYKDDKTCGVIRDDP
AYGYREVAAPIGVIAGIIPTTNPTSTTIFKALLALKTRNGIIFAPHPRAAKSTVEAARIV
HEAAVAAGAPRGIIGWVEAPTPDLTRQLMQHRGVALILATGGPGMVHAAYSSGKPAIGVG
AGNTPVVVDASANVKMAVNSIILSKTFDNGMICASEQAVIVEDAAADAVKAEFAARGCHF
ASPQEAEALAGVVFTDGRLNAAIVGRSAAEIAAMAGITVPPTTKILIAERDAIDPLDPFA
HEKLSPVLGFYRAPDFAAAVDMAQRLVELGGAGHTSVLYTNEANRERIVHFQNVLTTGRT
LVNMPSSQGAIGDVYNFELAPSLTLGCGSWGDNSVSENIGVKHLMNVKTVAERRENMLWF
RVPPKIYFKMGALRLALEDMRDRKRAFIVTDRTMEDLGHVGKVTAVLEKLGIQFRVFSDV
KPDPDLSGTYAALDSIRAFRPDMFIALGGGSPMDAAKIMWLMYEQPDLKFEEISLRFMDI
RKRVHAFPALGKKAVMVAVPTTSGTGSEVTPFAVITDDATGMKYPIADYELTPDMAIVDP
EFVMDMPKTLTAHSGLDALTHAVEAFTSTYANNFSDGNALEAVRLVFKYLRRAYNDGARD
VMAREKMHYAGTIAGMAFANAFLGVCHSMAHKLGAAFHMPHGLANALLLSHVIEYNATDT
PTKQGLMPQYRYPFVKGRYARIADMLGLTEGCGDDRDRKVARLVQAIEQLKADLNVPGSL
REAGIAEADFLERVDLLAEQAFDDQCTGGNPRYPLIAEIRELYLKAYYGAPLASLASPPP
AKAG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagcccaacgcacagggcgcgaaaccggccaccacgccggacgccatctcc
ctgaacgacatctccccaagcagcatcgccccaaacagcatcactgtggacgacatcgtc
acccgcgtgaacgaggcgcagcgcgccttcgccaacttcacccagcagcaggtcgacgcc
atcttccacgccgccgctgccgccgccacggcccagcgcatccaccttgcccgcatggcc
gtgcaggaaacgggcatgggcattctggaagacaaggtgatcaagaaccacttcgcctcg
gaatacatctacaacaagtacaaggacgacaagacctgcggggtcatccgcgacgacccg
gcctacggctaccgcgaggtggccgcgcccatcggggtcatcgcgggcatcatccccacc
accaaccccacctccaccaccatcttcaaggcgctgctggcgctgaagacgcgcaacggc
atcatcttcgcgccgcacccgcgcgccgcgaaatccacggtggaagccgcgcgcatcgtg
cacgaggccgccgtggccgcgggcgcgccgcgcgggatcatcggctgggtggaagcgccc
acgcccgaccttacccgccagctcatgcagcaccggggcgtggcgctgatcctggccaca
ggcgggccgggcatggtgcatgccgcctacagctcgggcaagcccgccatcggtgtgggc
gcgggcaacaccccggtggtggtggacgccagcgccaacgtgaagatggcggtgaactcc
atcatcctgtcgaaaaccttcgacaacgggatgatctgcgcctctgagcaggcggtgatc
gtggaggacgcagcggcggacgcggtgaaggccgaattcgcggcgcgcggctgccacttt
gcctcgccgcaggaagcggaggcccttgcgggcgtggtgttcaccgacggcaggctcaac
gcggccatcgtggggcgatcggcggcggaaatcgcggccatggcgggcatcaccgtgccg
ccgaccaccaagatcctcatcgcggaacgcgacgccatcgacccgctggacccgttcgcg
cacgaaaagctttcgcccgtgctgggcttctaccgcgcgcccgacttcgccgccgccgtg
gacatggcccagcgcctggtggaactgggcggggccgggcacacctcggtgctgtacacc
aacgaggccaaccgcgagcgcatcgtccactttcagaacgtgctgaccaccgggcgcacc
ctggtcaacatgccctcgtcgcagggcgccatcggcgacgtgtacaacttcgagttggcg
ccctcgctgacgctgggctgcggctcgtggggggacaattccgtcagcgaaaacatcggg
gtgaagcatctcatgaacgtgaagaccgtggccgaacggcgcgagaacatgctgtggttc
cgggtgcccccgaaaatctacttcaagatgggggcgctgcgcctggcgctggaagacatg
cgcgacaggaagcgcgccttcatcgtcaccgaccgcaccatggaagacctgggccacgtg
ggcaaagtgaccgccgtgctggaaaagctgggcatccagttccgggtgttcagcgacgtg
aagcccgaccccgacctgtccggcacctacgcggcgctcgattccatccgcgccttccgg
ccggacatgttcatcgccctcggcggcggctcgcccatggacgcggccaagatcatgtgg
ctgatgtacgagcagccggacctgaagttcgaggaaatttccctgcgcttcatggacatc
cgcaagcgggtccatgcctttccggcgctgggcaagaaggcggtgatggtcgctgtgccc
accacctcgggcaccgggtcggaggtgacgccctttgccgtcatcaccgacgacgccacg
ggcatgaagtaccccattgccgactacgaactgacgccggacatggccatcgtggacccg
gaattcgtcatggacatgccgaagacgcttaccgcgcattccgggctggacgccctgacc
cacgcggtggaggccttcacctccacctatgccaacaacttcagcgacggcaacgcgctg
gaggccgtccggctggtcttcaagtacctgcgccgggcgtacaatgatggcgcgcgcgac
gtgatggcccgcgaaaagatgcactatgcgggcaccatcgcgggcatggccttcgccaac
gccttcctgggggtgtgccattccatggcgcacaagctgggggccgcgttccacatgccg
cacggccttgccaacgcgctgctgctttcgcacgtcatcgagtacaacgccaccgacacc
cccaccaagcaggggctgatgccgcagtaccgctaccccttcgtcaaggggcgctacgcg
cgcatcgccgacatgctggggctgaccgaaggctgcggcgacgaccgcgaccgcaaggtg
gcccggctggtgcaggccatcgagcaactgaaggccgacctgaacgttcccggctcgctg
cgcgaggcgggcattgccgaggcggactttctggaacgggtggacctgctggccgaacag
gccttcgacgaccagtgcaccggcggcaacccgcgctacccgctgatcgccgaaatccgc
gaactgtacctgaaggcgtactacggcgcaccgctggcctcgctggcttcgccgcccccc
gccaaggcagggtag

DBGET integrated database retrieval system