KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2673Help
Entry
DvMF_2673         CDS       T00816                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_2673
   00030 Pentose phosphate pathway
    DvMF_2673
   00051 Fructose and mannose metabolism
    DvMF_2673
   00052 Galactose metabolism
    DvMF_2673
   00500 Starch and sucrose metabolism
    DvMF_2673
   00520 Amino sugar and nucleotide sugar metabolism
    DvMF_2673
  Nucleotide metabolism
   00230 Purine metabolism
    DvMF_2673
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DvMF_2673
Enzymes [BR:dvm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DvMF_2673
    5.4.2.8  phosphomannomutase
     DvMF_2673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3375453..3376847)
Genome map
AA seq 464 aa AA seqDB search
MKPISDRPFRAYDIRGIVDADFDAEWVERLGRACGTYLLERGIGAAVVGHDCRHSSPAYH
DALTAGLIACGIDVVSVGMVPTPLLYFAVRHLERQGGIMITASHNPPEYNGFKVWAGQTT
IHTTEIRRIYEIFAAGRFASGKGVGCTMDIVPAYMEAVTQRVQLAPRARGPLKVVVDGGN
GAGGDICADLLRRLGADVIEQYCDPDGAFPNHHPDPVVEANMRDLIARVASEGADLGIGL
DGDADRLGAVDAQGRLLFGDELLSLFARDLLARVPGGEVMADVKCSHRLFRDIEAHGGKP
TMWITGHSVMKARMLEVNAPLAGEMSGHMFFNEGWYGFDDAIYAAALLLRILSASDVPLT
ALPGWPPSHATPELHMPCPDELKFAVVSRAQEHFRALYDVNEIDGARITWPDGWALVRAS
NTQPVLVLRFEAETPERLAEIRTLVETPLAAWIAEARAARDATA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatttcggaccgcccgttccgggcctatgacatacgcggcatcgtcgatgcc
gacttcgacgccgaatgggtggagcgcctgggccgcgcctgcggcacctacctgctggaa
cgcggcatcggcgccgccgtggtgggacacgactgccgccacagctcccccgcctaccac
gacgcgctcaccgccgggctcatcgcctgcggcatcgacgtggtcagcgtgggcatggtg
cccacccccctgctgtacttcgccgtgcgccacctggagcgccagggcggcatcatgatc
actgccagccacaacccgccggaatacaacggcttcaaggtgtgggccgggcagaccacc
atccacaccaccgagatccggcgcatctacgagatattcgccgccgggcgctttgcctcg
ggcaagggcgtgggttgcaccatggacatcgtgcctgcctacatggaagccgtgacgcaa
cgggtgcagctggccccgcgcgcccgcggccccctgaaggtggtggtggacggcggcaac
ggcgcgggcggcgacatctgcgccgacctgctgcgccgcctgggcgcggacgtgatcgaa
cagtactgcgacccggacggggcctttcccaaccaccaccccgacccggtggtggaagcc
aacatgcgcgacctgatcgcccgcgtggccagcgaaggcgcggacctgggcataggcctg
gacggcgacgccgaccggctgggcgcggtggacgcgcagggccgcctgctgttcggcgac
gagctgctctcgctcttcgcacgcgacctgctggcccgcgtgcccggcggcgaggtgatg
gccgacgtgaagtgttcgcaccgcctgttccgcgacatagaggcccacggcggcaagccc
accatgtggatcaccggccattcggtgatgaaggcccgcatgctggaggtcaacgcgccg
ctggcgggcgagatgagcgggcacatgttcttcaacgaggggtggtacggcttcgacgac
gccatctacgccgccgccctgctgctgcgcatcctgtcagcgtccgacgtgccgctgacg
gcgctgcccggctggccgccctcgcatgccacgcccgaactgcacatgccctgcccggac
gaactgaagtttgccgtggtgagccgcgcacaggaacacttccgcgcgctgtacgacgtc
aacgagatcgacggcgcgcgcatcacctggcccgatggctgggcactggtgcgcgcctcg
aacacccagccggtgctggtgctgcgcttcgaggcggaaacgccggagcgcctggccgaa
atccgcactctggtggaaacgccgctcgctgcctggatagccgaggcccgcgcggccagg
gacgccacggcatag

DBGET integrated database retrieval system