KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2783Help
Entry
DvMF_2783         CDS       T00816                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
dvm00010  Glycolysis / Gluconeogenesis
dvm00620  Pyruvate metabolism
dvm00640  Propanoate metabolism
dvm00680  Methane metabolism
dvm01100  Metabolic pathways
dvm01110  Biosynthesis of secondary metabolites
dvm01120  Microbial metabolism in diverse environments
dvm01130  Biosynthesis of antibiotics
dvm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DvMF_2783
   00620 Pyruvate metabolism
    DvMF_2783
   00640 Propanoate metabolism
    DvMF_2783
  Energy metabolism
   00680 Methane metabolism
    DvMF_2783
Enzymes [BR:dvm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DvMF_2783
Lipid biosynthesis proteins [BR:dvm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DvMF_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N TFX_C
Motif
Other DBs
NCBI-ProteinID: ACL09721
UniProt: B8DR84
Position
complement(3521097..3523052)
Genome map
AA seq 651 aa AA seqDB search
MPFTGGTIDALLREERVFRPLPQVVAGAVVNPQDVARARARAAADPDGYWEEAAEELEWF
RRWDAVHDGSNAPFHRWFTGARCNIVHNALDRHIETGTKNRLALIWEGESGDTRSFTYYQ
LYREVNRLANALRGLGVGKGDRVIIYMPPLPETVFAMLAAAKIGAVHSTVFGGFSARSLR
DRMEDARPAVIVTVDGFYRNGRVIPLKPIADEAVATLPPDLAAGVRHMVVVHRAHVETPM
TEGRDIWYHDAVRGQHHEALTEIMDSTDPLFLLYTSGTTGKPKGHVHAHGGYMVGVHRTM
RWVFDVKPTDIFWCTAEPGWITGHSYVVYGPLMAGTTTVLYEGHPLYPEPGRVWSMVERL
GITILYTAPTLVRMLMRHGAQHVARHDLTTLRLLGTVGEPISPEAWLWFHRHVGRGRCPV
LDTWWQTETGMIMLSPLPVSLLKPGSVTRPLPGIEADVVDEHGKPVGPGHGGLLVLQRPW
PAMSCGVYNDDESYRRLYWERFPGWYCTGDVARRDEDGYFWIQGRADDVLLIAGHRIGTA
EMEAALASHRSVAECAVIGVPDALRGEVAKAFVVLVDDHPPLGTMVNADELAAELVEHVR
RELGPVAVIREVSFREGLPRNRSGKIMRRVLRSEELGRDTGDLSTLEDGYV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgccctttaccggcggcaccatagacgccctgctgcgcgaggaacgcgtgttccgcccc
ctgccgcaggtggtggccggggccgtggtcaacccgcaggacgtggcccgcgcccgcgcc
cgcgccgccgccgaccccgacggctactgggaagaggcggcggaagaactggaatggttc
cgccgctgggacgcggtgcacgacggcagcaacgcccccttccaccgctggttcaccggc
gcgcgctgcaacatcgtgcacaacgcgctggaccggcacatcgaaaccggcaccaagaac
cgcctggccctgatctgggaaggcgaatccggcgacacgcgcagcttcacctactatcag
ctgtaccgcgaggtgaaccgtctggccaacgcgctgcgcggcctgggcgtgggcaagggc
gaccgggtgatcatctacatgccgcccctgccggaaacggtgttcgccatgctggccgcc
gccaagatcggcgcggtgcattccacggtgttcggcggcttttccgcccgctcgctgcga
gaccgcatggaggacgcccgccccgccgtcatcgtcacggtggacggcttctaccgcaat
ggccgggtcatcccgctgaaacccatcgccgacgaggccgtggccaccctgccccccgac
cttgccgccggggtgcgccacatggtggtggtgcatcgcgcccacgtggaaacacccatg
accgaagggcgcgacatctggtaccacgatgccgtgcgcggccagcaccacgaggcgctt
accgagatcatggacagcaccgacccgctgttcctgctttacacctccggcaccacgggc
aagcccaagggtcacgtgcacgcccacggcggctacatggtgggggtgcaccgcaccatg
cgctgggtgttcgacgtgaagcccacggacatcttctggtgcacggcggaaccgggctgg
atcaccgggcacagctacgtggtgtacgggccgctcatggcgggaaccaccacggtgctg
tacgaagggcaccccctgtacccggaaccggggcgggtgtggtccatggtggaacgcctc
ggcatcaccatcctgtacaccgcgcccaccctggtgcgcatgctgatgcgccacggcgcc
cagcacgtggcccggcacgacctgaccaccctgcgcctgctgggcacggtgggcgaaccc
atcagcccggaagcgtggctgtggttccaccggcatgtgggacgcgggcgctgcccggtg
ctggacacctggtggcagactgagacgggcatgatcatgctcagccccctgccggtgtcg
ctgctgaagcccggctcggtcacccgcccgttgcccggcatcgaggccgacgtggtggac
gagcacggcaagcccgtgggtccggggcacggcggcctgctggtgctgcaacgcccgtgg
cccgccatgtcctgcggggtgtacaacgacgacgaaagctatcgccgcctgtactgggag
cgctttcccggctggtactgcaccggcgacgtggcccgccgcgacgaggacggctacttc
tggatccagggccgggccgacgacgtgctgctcattgccgggcaccgcatcggcacggcg
gagatggaggcggcgctggcctcgcaccgctcggtggcggaatgcgcggtcatcggcgtg
cccgacgcgctgcgcggcgaggtggccaaggccttcgtggtgctggtggacgaccacccg
ccgctgggcaccatggtcaatgccgacgaactggccgccgaactggtggaacacgtgcgg
cgcgaactggggccggtggcggtgatccgagaggtgtccttccgcgaggggctgccccgc
aaccgcagcggcaagatcatgcgccgggtgctgcgcagcgaggaactgggccgggatacg
ggggatttgtcaacgttggaagacggctacgtatag

DBGET integrated database retrieval system