KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_2814Help
Entry
DvMF_2814         CDS       T00816                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dvm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3558242..3559546
Genome map
AA seq 434 aa AA seqDB search
MPCRTLFLRSVDDWKELQALLAGRDNPGDTVEPAVREILDTVRAGGDAALADYTSRFDCP
GFDAARIRVGEDEIAAALEEVGPDDRAIIAEAAANIRAFHEAQKEQSWFTTRPDGSVLGQ
MVTPVDRAGLYVPGGQGGNTPLISSLLMNAIPAQVAGVPEIAVISPPRKDGTLNPFILAA
AHHLGITEVHRAGSAWAIAALAFGTETVRPVDVIAGPGNIWVTTAKRLLIGRVGIDMIAG
PSEILILADHTARADWVAADMLSQAEHDPLASSICITDSPALVDALKLELAAQCDTLPRA
DIARKALADWGAIVVVPDMATGIGITNKVAPEHLEVLTKDPWALLGTIRHAGAVFLGGWS
PEPVGDYYAGPNHVLPTMGTARFSSALSVQTFCKRTSVISATAAFTRGHAASIARLARLE
GLEAHARSAESRNR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccttgccgtacgctcttcctccggtcggtggacgactggaaggaactgcaggccctg
ctcgcgggacgcgacaatcccggcgacaccgtggaacccgccgtccgcgagattctggat
accgtccgcgccgggggcgatgccgccctggccgactacaccagccgtttcgactgcccc
ggcttcgatgccgcgcgcattcgcgtgggtgaagatgaaatcgccgccgccctcgaagag
gtcggccccgacgaccgggccatcattgccgaagccgccgccaacatccgcgcctttcac
gaggcgcagaaggaacagtcgtggttcaccacccggcccgacggttccgtgctgggccag
atggtcacccccgtggaccgcgccgggctgtacgtgcccggcgggcagggcggcaacact
ccgctcatttccagcctgctgatgaacgccattccggcccaggtggccggggtgccggaa
atcgccgtcatttcgccgccccgcaaggacggcacgctgaacccgttcattctcgccgcc
gcgcatcatctcggcatcaccgaggtgcaccgcgcgggcagcgcctgggccatcgccgcc
cttgccttcggcaccgagacggtgcgccccgtggacgtcatcgccggaccgggcaacatt
tgggtgaccacggccaagcggctgctcataggccgggtgggcatagacatgatcgccggg
cccagcgagatactcatccttgccgaccacaccgcccgcgccgactgggtggccgccgac
atgctgtcgcaggccgagcacgacccgctggcctcgtccatctgcatcaccgattcgccc
gcgctggtggacgcgctgaagctggaactggccgcccagtgcgacacgctgccccgcgcg
gacattgcccgcaaggcgctggccgactggggcgccatcgtggtggtgcccgacatggcc
accggcatcggcatcaccaacaaggtggcgccggagcatctggaagtgctgaccaaggat
ccgtgggcgctgctgggcaccatccgccatgccggggccgtgttcctgggcggctggtcg
ccggaaccggtgggcgactactacgccggccccaatcacgtgctgcccaccatgggcacc
gcgcgtttctcgtcggccctttcggtgcagaccttctgcaagcgcaccagcgtcatttcg
gccaccgccgcgttcacgcgcgggcatgccgcgtccatcgcgcggctggcccggctggaa
gggctggaggcgcacgcccgctcggcggaatcgcgcaacaggtag

DBGET integrated database retrieval system