KEGG   Desulfovibrio vulgaris Miyazaki F: DvMF_3204Help
Entry
DvMF_3204         CDS       T00816                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dvm  Desulfovibrio vulgaris Miyazaki F
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DvMF_3204
Enzymes [BR:dvm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DvMF_3204
DNA repair and recombination proteins [BR:dvm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DvMF_3204
    RecFOR pathway proteins
     DvMF_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4037171..4037779
Genome map
AA seq 202 aa AA seqDB search
MIAYVEGRVAEISGNACVVVTEGGVGYEVHLPAHTLSRLPERGGQVAFHVRTEVREDALE
LFGFSTWDERQTFMVLTTISKVGARTALAILSQFRPDDLRRLVVEDDVLALTRVSGIGKK
TAQHIFLELKYKLKVEDLPAGLVLAGGAAPGGVFRDALAGLGNLGYLEDEAAPVLKEVLK
AEPDLDVAGALRAALKALARGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtatgtcgaaggccgcgttgccgaaatttccggcaatgcctgcgtggtggtg
acggaagggggcgtggggtacgaggtgcacctgcccgcgcacaccctgtcgcgcctgccg
gaacgcggcgggcaggtggcctttcacgtgcggacggaagtgcgcgaggatgccctggaa
ctgttcggcttttccacctgggacgaacggcagaccttcatggtgctcaccaccatcagc
aaggtgggcgcgcgcacggccctggccatcctttcgcagttccgacccgacgacctgcgc
cgcctggtggtggaggacgacgtgctggcgctgacgcgggtgtccggcatcggcaagaag
accgcgcaacacatctttctggaattgaagtacaaactgaaggtggaagatctgcccgcg
ggccttgtgctggcgggcggggccgcgccgggcggggtgttccgcgatgcgctggccggg
cttggcaaccttggctacctcgaggacgaggccgccccggtgctgaaggaagtgctgaag
gccgagccagaccttgacgtggccggggcgctgcgcgcggccctgaaggccctggcgagg
gggcgctga

DBGET integrated database retrieval system