KEGG   Desulfovibrio vulgaris Hildenborough: DVU0074Help
Entry
DVU0074           CDS       T00171                                 

Definition
(RefSeq) polysaccharide biosynthesis domain-containing protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00521  Streptomycin biosynthesis
dvu00523  Polyketide sugar unit biosynthesis
dvu01130  Biosynthesis of antibiotics
Module
dvu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DVU0074
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DVU0074
Enzymes [BR:dvu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DVU0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-GeneID: 2795013
NCBI-ProteinID: YP_009299
UniProt: Q72FY9
Position
90988..91431
Genome map
AA seq 147 aa AA seqDB search
MDGIAGVETQDLRIIPTDGGPVLHMLRPDAPLFMGFGELYFSEVLPGAVKAWKRHTRQTQ
HFAVPVGRLKVVVYDDREGSPTRGRVEEHILGRPDAYRLLRIPPLVWYGFTAVGDVPALI
CNCADIPHDPQEGERKDRDSADIPYHW
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggacggcatagccggggtcgagacgcaagacctgcgcatcatccccaccgacggcggg
ccggtgctgcacatgctgcggcccgacgcgcccctgttcatgggcttcggcgagttgtac
ttctccgaggtgctgcccggcgcggtgaaggcgtggaagcgccacacccgccagacccag
catttcgccgtgccggtgggacgcctcaaggtcgtcgtctacgacgaccgcgaagggtcg
cccacccgcgggcgcgtggaggaacacatcctcggacgacccgatgcctaccgcctgctg
cgcattccgccgctggtgtggtacggcttcaccgccgtgggtgatgtgcccgcgctcata
tgcaattgcgccgacatcccgcacgacccgcaggagggcgagcgcaaggacagggattcc
gccgacatcccgtaccactggtag

DBGET integrated database retrieval system