KEGG   Desulfovibrio vulgaris Hildenborough: DVU0085Help
Entry
DVU0085           CDS       T00171                                 

Gene name
trpB-1
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00260  Glycine, serine and threonine metabolism
dvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01130  Biosynthesis of antibiotics
dvu01230  Biosynthesis of amino acids
Module
dvu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVU0085 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DVU0085 (trpB-1)
Enzymes [BR:dvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DVU0085 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 2793579
NCBI-ProteinID: YP_009310
UniProt: Q72FX8
Position
104165..105409
Genome map
AA seq 414 aa AA seqDB search
MTATATTLHRPDTSTGFFGAYGGQFVPDQLKPILDDLAATFDACKDDPSFIEEFTYYLTR
YSGRATPLFLCSNLTARLGGARIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKVIAET
GAGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMSGQRTLKEAV
DEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREARAQILEAEGRLPDCCIAC
VGGGSNAIGLFAEFVPDTSVRLIGVEPAGRGLTYGDHAATLCLGEPGVLHGFYSYMLKDD
KGEAAAVYSISAGLDYPGVGPEHSHLKDMNRAEYVSVTDVEAVDAFFTLSRAEGIIPALE
SSHALAHAMKMAPAMPKDAIIVVNLSGRGDKDVAQIEEMVSNGLVTPPAMVRGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaccgccaccacccttcatcgtcccgacacctccaccggcttcttcggcgcg
tatggcgggcagttcgtgcccgaccagctcaagcccatcctcgacgacctcgctgccacc
ttcgacgcctgcaaggacgacccttcgttcatcgaagagttcacctactacctcacccgg
tattccgggcgggcgacgcctctcttcctgtgctccaatctgaccgcacggcttgggggg
gcgcgtatctatctcaagcgcgaagacctcaaccacctcggggcccacaaggtgaacaac
accatcggccagattctgcttgccaaacgcatgggcaagaagaaggtcatcgccgagacc
ggggccgggcagcatggcgttgccaccgcagccaccgcggcgctcatggggatgcagtgc
accatctacatgggggctgaggacatggagcgccagaagctcaacgtcttcaggatgcgc
atgatgggggcggaggtcgtgcccgccatgagcggtcagcgcaccctcaaggaagcggtg
gacgaggccctcgccgcatgggtgcaggacgccaacgagacgttctacctcttgggttcg
gcggtggggccgcatccataccccgccatcgtgcgtcatttccagtcggtcatcggtcgt
gaggcgcgtgcccagatacttgaggccgaaggacgcctgcccgattgctgcatcgcgtgc
gtgggtggtgggtccaacgccatcggtcttttcgcggagttcgtgccggatacgtcggtg
cgtctcatcggggtcgaacctgccggacgcggtctcacctacggcgaccatgccgcaacc
ctgtgccttggtgaacccggcgtcctgcacgggttctattcctacatgctcaaggacgac
aagggtgaggccgctgccgtgtattccatctcggcagggctggactaccccggtgtcggg
cctgaacacagccacctcaaggacatgaaccgggccgaatacgtcagtgtgacggacgtg
gaggctgttgatgccttcttcaccctgtcgcgtgccgagggcatcatccccgcgctggaa
tcgtcccatgctctcgcccatgccatgaagatggcgcctgccatgccgaaggacgccatc
atcgttgtgaatctctccgggcgcggcgacaaggacgtggcacagatagaggagatggtg
tcgaacgggcttgtgacaccccctgccatggtgcgtgggctgtaa

DBGET integrated database retrieval system