KEGG   Desulfovibrio vulgaris Hildenborough: DVU0158Help
Entry
DVU0158           CDS       T00171                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dvu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
195388..196386
Genome map
AA seq 332 aa AA seqDB search
MQPVLRPIGTVRSRLTRLDDCPKNGDEGAPEAWIDILPEFAAGLDTLEAGQELTLVTWLH
LADRDTLAVHPRGDTSRPMRGVFNTRSPARPNPLGLHDVRLLGTAPGPDGMVRLLVAPLE
ALHGTPVVDIKTSLSQRRDTGWGDGVPLREAETVRRLCHTAWQRGLLSGFNGNVSLRLGA
TCLVTCTGAAKGDLSPGDLAVVDIASGKRIAGGKPSSELAMHLEVYRRQPRAQAIVHTHP
PRLLALGLRVAPQQMLHIDVYEAQMLVSRLGSAPAHAPGTQALADAVGEAAVTREAVWME
RHGLVCWGETPMQALALGEELEHLAGIHLSVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgtattgcgtcccatcggcaccgtgcgctcgcgtctgacccgcctcgacgac
tgtcccaagaacggagacgagggggcccccgaggcatggatagacatcctgcccgaattc
gcggcggggctggatacgctggaggcagggcaggaactgaccctcgtcacgtggctgcat
ctcgccgaccgcgacacactcgcagtgcatccgcgtggcgacacgtcgcggcccatgcgc
ggggtgttcaacacccgttcgcccgcccgtccgaaccccctcggcctgcacgacgtgcgc
ctcctgggcaccgcccccgggccggacgggatggtgcgccttctggtggcaccgcttgag
gccctgcacggcactccggtggtggacatcaagaccagcctcagccagcggcgtgatacg
ggatggggcgacggcgtccctctgcgtgaggccgagacggttcgccgtctgtgtcacacg
gcgtggcaacggggtctgctttcgggcttcaacggcaacgtgagcctgcgcctaggggcg
acctgtctcgtcacctgtacgggggcggccaagggcgacctctctcccggcgacctcgcc
gtggtcgacatcgcctccggcaagcgcatcgcaggaggtaagccttcctctgaactcgcc
atgcaccttgaggtctatcgtcggcagccccgggcacaggccatcgtgcacacgcatccg
ccacgcctgctggccctcgggctgcgtgtcgccccgcagcagatgctgcacatcgacgtc
tacgaggcgcagatgctcgtatcgcgcctcgggtctgcccccgcccatgcccccggaacg
caggcactggccgatgccgtgggcgaggcggccgtcacccgcgaggcggtctggatggaa
cgccacgggctggtgtgctggggggagacgcccatgcaggcgcttgcgctgggtgaagaa
ctggaacacctcgcgggcatccatctctcggttttgtag

DBGET integrated database retrieval system