KEGG   Desulfovibrio vulgaris Hildenborough: DVU0421Help
Entry
DVU0421           CDS       T00171                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dvu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
473967..474839
Genome map
AA seq 290 aa AA seqDB search
MTDSPHKRFLASELDDIAPEEARFHVIPAPFEASVSYGGGTGAGPDAILDASDQLELWDG
LSIPAAQGIHTHPPVDCTGDAEAVLDRISRATRSVLDAGGTPVLLGGEHTVTYGALAALR
ERFGRFGVVQFDAHADLRDSYEGSRWSHASVMRRAVSDLGLPLVQYGVRALCTEEVAFRR
EAGVTHWDAAQLARSGVPARPLPDDFPESVYVTFDVDGLDPSIMPATGTPVPGGLGWYDA
LRLVERSVSGRRVLGFDVVELAPIAGWHAADFAAARLVYDIMGIIQRMAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcgccgcacaagcgttttctggcttccgaactggacgatatcgcgccggaa
gaggcccggttccatgtcatccccgcgcctttcgaagcctctgtctcgtatggaggggga
acgggcgcagggcctgacgccatcctcgacgcctctgaccagcttgagttgtgggacggg
ttatccatcccggcggcgcagggcatccacacgcacccccccgtggactgcacgggcgac
gccgaggcggttctcgaccgcatctcccgagcgacccgaagcgttcttgatgcggggggg
acgcctgtcctgctgggtggtgagcacaccgtcacctatggggcacttgcggccctgcgt
gaacggttcggccgattcggggtggtgcagttcgatgcccatgccgacttgcgcgacagc
tacgaggggtcgcggtggagtcacgccagcgtgatgcggcgtgccgtgtccgaccttggg
ctaccgcttgtgcagtacggggtgcgcgccttgtgcacggaagaggtggctttccggcgt
gaagccggggtgacgcactgggatgcggcgcaactggcccgttcaggcgtgcctgcacga
ccgcttcccgatgactttccggaaagtgtctatgtgactttcgatgtggacggcctcgac
ccttccatcatgcccgccacgggaacgcccgtgccgggtgggcttggctggtatgatgcc
ctgcggctggtggaacgttccgtgtccggacgcagggtgctcggtttcgatgtcgttgaa
ctcgcccccatcgcaggatggcacgccgccgatttcgcggcagcgcggctggtctacgac
atcatgggcatcatccagcgcatggcccgatga

DBGET integrated database retrieval system