KEGG   Desulfovibrio vulgaris Hildenborough: DVU0468Help
Entry
DVU0468           CDS       T00171                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01130  Biosynthesis of antibiotics
dvu01230  Biosynthesis of amino acids
Module
dvu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DVU0468 (trpC)
Enzymes [BR:dvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DVU0468 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth DUF2922
Motif
Other DBs
NCBI-GeneID: 2793609
NCBI-ProteinID: YP_009692
UniProt: Q72EV0
Position
536049..536822
Genome map
AA seq 257 aa AA seqDB search
MLERFRAAKRHEVDKLEQCARRGGLPAPFAGPRPAFGTALRGDGLAVIAEYKRASPSCGV
IDTKLTPEEVATAYEAGGATAISVLTEEVHFRGELSYLGRMTAPGLPLLRKDFIMHPLQV
TATAATPASALLLIVRLTPDAALLRDLREQAEAQGMDAVVEVFDTDDLDIARASGARIIQ
VNARDLDTLKVSMPACLGMGVLRDAAETWVAASGMSAPEHLAAAATAGYDAALVGTALMR
GGDPGAALRALLGREAA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacgtttccgcgccgccaagcggcatgaggtggacaaactggagcaatgcgcc
cgccgtggcggtctgcctgcgcctttcgcaggcccgcgccccgcgttcggtactgccctg
cgcggcgacggtcttgccgtcatcgccgagtacaagcgggcctcgccctcatgcggggtc
atcgacacgaagctgactcccgaagaggtggccacggcctatgaggcgggcggggccacc
gccatctcggtactcaccgaggaagtgcacttcaggggtgagctttcatacctcggccgc
atgaccgcgccgggtctgcccctgctgcgcaaggacttcatcatgcaccccttgcaggtg
acggccacggccgccacacccgcctcggccctgctgctcatcgtgcgcctcacgcccgac
gcggccctgttgcgcgacctgcgtgaacaggcagaggcgcaaggcatggacgccgtggtg
gaggtcttcgacaccgacgacctcgacatcgcaagggcatcgggggcgcgcatcattcag
gtcaacgcccgcgacctcgacacgctcaaggtgagcatgcctgcctgccttggcatgggc
gtcttgcgcgatgcggcggagacgtgggtggcggccagcgggatgtctgccccggaacac
ctcgccgccgcagccaccgccgggtacgacgcggcactggtgggcacggccctgatgcgc
gggggcgaccccggtgcggccctgcgtgcactgctggggcgggaggcggcgtga

DBGET integrated database retrieval system