KEGG   Desulfovibrio vulgaris Hildenborough: DVU0471Help
Entry
DVU0471           CDS       T00171                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DVU0471 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVU0471 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DVU0471 (trpA)
Enzymes [BR:dvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DVU0471 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538905..539678
Genome map
AA seq 257 aa AA seqDB search
MSASRLERRIREAQAAGRPALIPFLTAGFPTKERFWDELEALDAAGADIIEVGVPFSDPV
ADGPVVAAASQRALESGVTLRWIMDGLAARKGRLRAGLVLMGYLNPFMQYGFERFVSDAA
DAGVAGCIIPDLPLDEDADLRALLAARDMDLIALVGPNTGEGRMREYAAVASGYVYVVSV
MGTTGVRDGLPVEVADTLARARQCFSIPVALGFGISRPAQLEGLSHPPDAVIFGSALLRH
LDAGGDAASFMKAWAER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtcacgtctcgaacggcgcattcgcgaggcacaggcggcggggcgtcccgcc
ctcatcccctttctgacggcgggcttcccgacgaaagaacgcttctgggatgaactcgag
gccctcgacgcggcaggggccgacatcatcgaagtgggcgtgcccttctccgaccccgtg
gcggacggcccggtggtggcggccgcctcgcagcgcgcgctggagtccggtgtgacgctg
cgctggatcatggacggactggcggcccgcaagggcaggctgcgtgcagggcttgtgctg
atggggtacctcaacccgttcatgcagtacggcttcgagcgtttcgtgagcgatgcggcg
gacgcaggcgtggcggggtgcatcatccccgacctgccactggatgaggacgccgacctg
cgggcactgcttgccgcgcgggacatggacctcatagcgctggtggggcccaacacgggc
gaagggcgtatgcgcgagtatgccgccgtcgcctcgggctacgtctatgtggtgtcggtc
atgggcaccacgggcgtgcgggacggcctgcccgtggaggtggcggacacgctggcgcgg
gcacgtcagtgcttctccatccccgtggcgctcggtttcggcatcagccgtccagcgcaa
ctggaggggctgtcacatccgcccgacgccgtcatcttcggttctgccctgttgcgtcat
ctcgacgcgggcggcgacgccgcctcgttcatgaaggcgtgggcggagagataa

DBGET integrated database retrieval system