KEGG   Desulfovibrio vulgaris Hildenborough: DVU0685Help
Entry
DVU0685           CDS       T00171                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU0685
   00030 Pentose phosphate pathway
    DVU0685
   00051 Fructose and mannose metabolism
    DVU0685
   00052 Galactose metabolism
    DVU0685
   00500 Starch and sucrose metabolism
    DVU0685
   00520 Amino sugar and nucleotide sugar metabolism
    DVU0685
  Nucleotide metabolism
   00230 Purine metabolism
    DVU0685
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DVU0685
Enzymes [BR:dvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DVU0685
    5.4.2.8  phosphomannomutase
     DVU0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759320..760681
Genome map
AA seq 453 aa AA seqDB search
MKALSAHVFRAYDIRGIVDTDFDPEWVERLGRACGTYFVSHGHGAAVVGFDCRHSSPAYH
DALVRGLLSTGVDVTSVGMVPTPVLYFAVKHLGRKAGVMITASHNPSEYNGFKVVAGEST
IHGEEIRRIWEVFERGEFASGHGIGCSHDIVPSYIEAITSDVHPARKLKVVVDGGNGAGG
ELCVEVLRRLGVEVVAQFCEPDGDFPNHHPDPVVEANMTALMERVQVERADLGIGLDGDA
DRLGAVDGMGRLLNGDELLSLYAREMLARRPGETVIADVKCSHRLFDDIEAHGGKPMMWI
TGHSVVKARMLEVGAPLAGELSGHMFFGDRWFGFDDAIYGAARLVELLAASDVPLTDLPG
WPPSHATRELHLPCPEHAKFEVVRRAQAYFRERCTINDIDGARVIFPDGWGLVRASNTQP
VLVLRFEAQTPERLAEIRAFVEEPLRRWVAELS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttatcggcccatgtgttcagggcctacgatatcagagggattgtcgacacc
gatttcgacccggaatgggtcgagagactcgggagggcctgcggaacctactttgtctcg
cacggtcacggggctgccgttgtggggttcgattgccgccacagttcgccagcctaccac
gacgcactcgtgcgcggcctgctgtcgacgggggtggatgtgaccagcgtgggcatggtg
cccaccccggtattgtatttcgccgtgaaacacctcgggcgcaaggccggggtcatgatc
acggcaagccacaatccatcggaatacaacgggttcaaggtcgtcgccggtgagtcgacc
atccacggcgaggagattcgccgcatatgggaggtcttcgagcgtggcgagttcgcttcg
gggcacggcatcgggtgttcccatgacatcgtgccctcctacatcgaagccatcacctct
gatgtgcaccccgcgcgcaagctgaaggtcgttgtcgacggaggcaacggtgctggcggc
gagctttgcgttgaagtgctgcgcaggctgggtgtggaggtcgtggcgcaattctgcgaa
cccgatggcgacttccccaaccatcaccccgaccccgtggtcgaggccaacatgaccgcg
ctcatggaacgcgtgcaggtcgaacgcgcagacctcggcatcggtctcgacggcgatgcc
gacaggcttggtgccgtagacgggatggggcggctgctgaacggtgacgaactgctttcg
ctctatgcgcgcgagatgctggcccgtagaccgggcgagacggtcatcgccgacgtcaaa
tgttcgcatcgccttttcgacgacatcgaggcgcacggcggcaagcccatgatgtggatc
acagggcactccgtggtcaaggcgcgtatgctcgaagtcggcgcaccgctggcgggtgag
ctttcggggcacatgttcttcggcgacagatggttcggcttcgacgacgccatctacggg
gctgcccgtctcgtggaactgctcgcagccagtgacgtgcccctgaccgacctgcccggc
tggccgccaagccacgcgacccgtgaattgcacctgccctgtccggagcacgccaagttc
gaagtcgtgcggagggcacaggcctatttccgtgagcgatgcaccatcaacgacatcgac
ggtgcgcgtgtgatctttcccgatggatggggccttgtgcgtgcctccaacacccagccg
gtgctcgtgttgcgtttcgaggcgcagacgccggaacgtctggccgagattcgcgccttc
gtcgaagaaccgttgcgacgctgggtcgcggaactttcatag

DBGET integrated database retrieval system