KEGG   Desulfovibrio vulgaris Hildenborough: DVU0687Help
Entry
DVU0687           CDS       T00171                                 

Definition
tungsten-containing aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DVU0687
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DVU0687
Enzymes [BR:dvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DVU0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
761222..763006
Genome map
AA seq 594 aa AA seqDB search
MTLRRWGMPIEGTASRVLHVDLESGASRVLLFEGRPHHLGGSGLAAALYDAYGLPESPAF
DPRQPLIFAIGPLSGFFPLMSKVVCGFRSPYTGEWAESHAGGRLALSLRFAGYDALMITG
RARTLSCLVVGSRRLEIHDVHYLRGQDVFTSGKYLRRYGKESSGHRSTVRIGPAGERGVT
FACANVDSFRHFGRLGAGAVMGGKNLKALVVTGDSGIELPEGRDYPKLYKEVYQSVTGTD
MMQKYHDLGTAENLLVLNELKALPWRNLQATTDPAIDGISGERFAEQLLLRQTACAGCPV
GCIHIGLLRQQFARDHEFLYKQVSYDYEPIFAQGSMLGLTNASDVLALLDETEKLGLDCM
SAGVALAWVAEAFEKGVVTEKETLGPVHFGNVATFVAALHHLANGTSEFWQALGKGVLYA
ADIYGGADFACVLGQEMAGYATGEVYFVSQALGFRHSHLDSGGYAYDQSAKDKDVDKAVR
HLLDDEYKRLTINCMVACLFARKAYPPERLQEALASLGMRAEADALPESGRAMQALRWSL
KFRTGFRPENVRIPKRFTEVVTWKGPMDVDYMDAVRQAYTSELYRMVVDAAREA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcggaggtggggcatgccgattgaaggaaccgcctcgcgcgtgctgcatgtg
gaccttgagtcgggtgcctcgcgtgtgctgcttttcgagggacgcccgcaccatctcggc
ggcagcgggcttgccgctgcactgtatgacgcctacgggttgccggaatctccggctttc
gacccgcggcagccgctcatcttcgccatcggaccgctttcggggttctttcccctcatg
agcaaggtcgtgtgcggcttccgttcgccgtacacgggagaatgggccgagagtcacgcg
gggggacgtcttgccctgtcgctgcgcttcgcgggatatgacgcgctgatgatcaccgga
cgggcgcgaacgctctcatgtcttgtcgtggggtcgcgtcgtctcgaaatccacgatgtc
cactacctgcgcggacaggacgtgttcacttccgggaagtatctgcgtcgctatggcaag
gagtcgtcagggcatcgtagcacggtgcgcatcgggcctgcgggcgagcgtggtgtcacc
ttcgcgtgcgccaacgtcgactcgttccggcatttcggacgactgggcgcaggtgccgtc
atgggcggcaagaatctcaaggcgctggtcgtgacgggcgactcgggcatcgaactgcct
gaagggcgcgactatccgaaactctacaaggaagtgtaccagtcggtcaccggtaccgac
atgatgcagaagtaccacgacctcggcactgccgagaacctgctggtgctcaatgaactg
aaggcgttgccgtggcgcaacctgcaagccacgacagaccccgccatcgacggcatctct
ggcgaacggttcgcggaacagcttctgctgcggcagaccgcctgcgcgggctgtccggtg
gggtgcatccacatcgggctgctgcgacagcagttcgcccgcgaccacgagttcctctac
aagcaggtgtcatacgactacgaacccatcttcgcgcagggttccatgctgggcctgacc
aacgcctccgacgtgcttgccctgctcgatgagacggagaaactcggccttgactgcatg
agcgccggtgtcgcactggcatgggtggcggaggcgttcgaaaagggtgtcgtcaccgag
aaggagacgctgggcccggtgcacttcggcaacgtggccacgttcgtcgccgcgctgcac
caccttgccaacggaacctccgaattctggcaggcgttgggcaagggggtgctgtatgcc
gcagacatctacggcggtgccgacttcgcctgtgtcctcggtcaggagatggcaggctat
gccacgggcgaggtgtatttcgtctcacaggccctggggttcaggcattcgcatctcgac
agcggcggctatgcctacgaccagtccgccaaggacaaggacgtggacaaggccgtgcgg
catctgctggatgacgagtacaaaaggctgaccatcaactgcatggtggcctgtctcttc
gcccgcaaggcctacccgccggaacgccttcaggaggcccttgcctctctcggcatgcgc
gccgaggccgatgccctgcccgagtcggggcgtgccatgcaggccctgcggtggtcgctc
aagttccgcacggggttccgtccggagaacgtgcgtatccccaaacggttcaccgaggtc
gtcacatggaagggccccatggacgtcgactacatggatgccgtgcgacaggcctacacg
tccgagttgtaccgcatggtggtggacgccgcacgggaggcatag

DBGET integrated database retrieval system