KEGG   Desulfovibrio vulgaris Hildenborough: DVU0698Help
Entry
DVU0698           CDS       T00171                                 

Gene name
rfbC
Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00521  Streptomycin biosynthesis
dvu00523  Polyketide sugar unit biosynthesis
dvu01130  Biosynthesis of antibiotics
Module
dvu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DVU0698 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DVU0698 (rfbC)
Enzymes [BR:dvu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DVU0698 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 2794449
NCBI-ProteinID: YP_009920
UniProt: Q72E80
Position
complement(773223..773795)
Genome map
AA seq 190 aa AA seqDB search
MHITETGLPGLRLLTPQAHRDERGFFLETYRESFFDTLTHGQRFVQDNHARSEDAGVLRG
LHFQLPPMTQAKLVWAVQGSIYDVAVDLREGSPTFGRWFGCTLTAASFQRIYVPRGFAHG
YMTLEPGTEVMYKVDAYYAPALEQGLPWNDPDIGITWPDMTPILSAKDQRHGTFRDFRTP
FSFTPDTEHA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcacagaaaccggacttcccgggttacggctgcttacgccacaggcccaccgg
gacgaacgtggcttttttcttgagacctaccgggagtcgttcttcgacaccctgacgcac
ggtcagcgcttcgtgcaagacaaccacgcgcgttcggaagatgcgggtgtcctgcgcggg
ctgcattttcagcttcctcccatgacgcaggcaaaactcgtctgggccgtccagggttcc
atctatgatgtcgccgtcgacctgcgcgagggctcgcccaccttcggacgctggttcggc
tgcaccctcaccgccgcatcgttccagcggatctatgtgccacgcggcttcgcccatggc
tacatgacgctcgaaccgggaacggaggtcatgtacaaggtcgacgcctactatgccccg
gcactggaacaggggctgccgtggaacgacccggacatcggcatcacatggcccgacatg
acacccatcctgtctgccaaagaccagcggcacggcaccttccgcgactttcgcaccccc
ttcagcttcactcccgacacggagcacgcatga

DBGET integrated database retrieval system