KEGG   Desulfovibrio vulgaris Hildenborough: DVU0701Help
Entry
DVU0701           CDS       T00171                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dvu01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dvu00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dvu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
778761..780950
Genome map
AA seq 729 aa AA seqDB search
MTGRIREGGLAVAEPLHRCIEREILPGTGISPSIFWAGLEELVGTLGPRNRELLARRDNM
QAAIDAWHKEHQGRPHDAAAYRRFLEDIRYLLPAPQDLAVETQGVDPEVATIAGPQLVVP
VTNPRYALNAVNARWGSLYDALYGSDVIADSDGAARGAAYNPLRGAKVVAYAAAFLDRTF
PLAGARHADVVRYELTGPPVGRKLSALCADGTVTGLLHPDAFAGYTGGERPTTVLLRNNG
LHVELQFDRRHPVGAAHPAGLKDVVLESAVTTILDCEDSVATVDAEDKALAYRNLLGLFR
GDLETSFDKGGRSVFRRLAADRTYTAPGGAAYALPGRSLMLVRNVGLLMTTDAVLDAAGQ
EIPEGILDGLVTACIGLHDLRGAGRHRNSGAGSVYIVKPKLHGPEEVAFVCEQFRRIEDI
LGMARNTLKMGVMDEERRTTLNLAECIRVASQRIIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAQRWMLAYEDWNVDTGLAAGFGGKAQIGKGMWPKPDRLAEMVATKGAHPRAGANC
AWVPSPTAATLHALHYHEVDVFARQRELAGCHRASLDDLLALPLMGEARPSPAEVREELE
NNAQSILGYVVRWVEMGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGICTEDEVR
DVMLRMATVVDRQNKDEPGYRPMSADPGSSVAFRAACDLVFEGARQPNGYTEPILHARRR
EVKARSLTR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacgcatacgtgaaggcggcctcgctgtggccgaacccctgcaccgttgtatc
gaacgcgagattctgccgggcaccggcatctccccctccatcttctgggcggggctggaa
gagcttgtcggcaccctcggcccccgtaaccgcgaattgctggcccgacgggacaacatg
caggcggcgatagacgcatggcacaaggagcatcaggggcggccgcacgatgccgcagcc
tacaggcgttttctcgaagacatccgttatctgcttcccgcaccgcaggacctcgcggtt
gaaacgcagggggtcgaccccgaagtggcgaccatcgccgggccgcaacttgtcgtgccc
gtgaccaacccccgctatgccctcaatgccgtcaacgcccgctggggcagcctctacgac
gccctgtacggcagcgacgtgattgccgacagcgacggggctgcacgtggcgctgcctac
aatcccctgcggggcgcgaaggtggtggcgtatgccgccgcgttcctcgacaggacattc
ccgttggccggggcgaggcatgccgacgtggtgcgctacgagttgaccgggccaccggtg
ggtcgcaagctgtcggccctctgtgccgacggtacggtgacgggcctgctgcatcctgat
gcgttcgccggctatacggggggagagcgcccgacgacggtgctgctgcgcaacaacggg
ctgcatgtcgaattgcagttcgaccgcaggcacccggtgggggctgcccaccctgcggga
ctcaaggatgtggtgctcgagtcggcggtgaccaccatcctcgattgcgaggattccgtg
gccaccgtcgatgccgaagacaaggccctcgcctatcgcaacctgcttggactgttccgg
ggcgaccttgagacctcgttcgacaagggcgggcgcagcgtcttcaggcgtctggcagca
gacaggacgtacaccgcaccgggcggggcagcgtatgccctgccggggcgcagcctgatg
ctggtgcgtaacgtggggctgctcatgaccaccgacgccgtgctcgacgcggcagggcag
gagattcctgaaggcatcctagacgggctcgtcaccgcctgcatcgggctgcacgacctg
cgcggtgcggggcgtcatcgcaacagcggagccggcagcgtgtacatcgtcaaacccaag
ctgcatggccccgaagaggtggcgttcgtctgcgagcagttcagacgcatcgaagacatc
ctcggcatggcgcgcaataccctcaagatgggggtgatggacgaggaacggcgaaccacg
ctcaatcttgcggagtgcatacgggtggcttcgcagcgtatcatcttcatcaatactggc
ttcctcgaccgtacgggcgacgagatacacacctgcatggaggcggggcccgtcgtgcgc
aagaacgacatgaaggcccagcgctggatgctcgcctatgaggactggaacgtggacacc
gggcttgccgccggtttcggcggaaaggcccagataggcaagggcatgtggcccaagccc
gacaggctggcggagatggtcgccaccaagggggcgcacccgcgtgccggggccaactgc
gcgtgggttccctctccaacggcggcgacgctgcacgccctgcactaccatgaggtggat
gtcttcgcgcgtcagcgcgaacttgccggatgtcaccgggcgtcgctggacgaccttttg
gcattgccgctcatgggtgaggcgcgtccctcgcccgctgaagtgcgcgaagaactggag
aacaacgcccagagcatcctcggctacgtggtacggtgggtcgagatggggataggctgc
tcgaaagtgcccgatatccatgacgtgggtctcatggaagacagggccaccctgcgtatc
tccagccagcacatcgccaactggttgcgccatggcatctgcacggaggacgaggtgcgt
gacgtcatgctacggatggcgaccgtggtcgacaggcagaacaaggatgaaccgggctac
cggcccatgtctgccgaccccggttccagcgtggcgttcagggcggcatgcgacctcgtg
ttcgagggggcgcgccagcccaacgggtataccgaacccatcctccatgcccgcaggcgc
gaggtgaaggcgcgtagtctcacccggtag

DBGET integrated database retrieval system