KEGG   Desulfovibrio vulgaris Hildenborough: DVU0734Help
Entry
DVU0734           CDS       T00171                                 

Definition
uroporphyrinogen III synthase/methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DVU0734
Enzymes [BR:dvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DVU0734
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DVU0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
819967..821478
Genome map
AA seq 503 aa AA seqDB search
MKVYLIGAGPGDPGLLTLKGKEILERADVVVYDFLANDAFLAYAKPDAEIIYVGKKGGDH
TLSQDGINRLIIEKAKEGKVVARLKGGDPYMFGRGGEEAEELLDAGVPFEEVPGVTSAIA
GPAYAGIPLTHRSYASSVSFITGHENPDKPDSAHNWQALAAGTSTLVFFMGMKNLPDISR
KLIAAGMSPDKPAALVRWGTTPRHRSLVATIATLPEEAVKHGFSNPSLIVVGDVVRLRDR
LNWFEHKPLLGKGVVVTRAREQASGLAAALRELGADVIQFPTIDIHPLDDYAPVHEAIRA
LDTYDWVVFTSVNGVKHFWNQLAALGLDSRALGGRKVAAIGPATADALRDKGIAPDFIPE
KYVAEGVVEGMLARGMGGKRVLLPRALEAREVLPEELRKAGATVDVLPVYVTVPSAARRD
DVLARMEAGEVHCVTFGSSSTVENFFSLVPADTVKAHPEVKLACIGPVTKKTLEGFGFTC
HIQPDDYTIPALVDELTRVLPEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctatctcatcggtgccggcccgggcgaccccggactgctcaccctcaagggc
aaggaaatcctcgaacgtgcggacgtggtcgtctacgactttctggccaacgatgccttc
ctcgcctatgccaagcccgatgccgaaatcatctacgtgggcaagaagggcggcgaccat
accctttcgcaggacggcatcaaccgcctcatcatcgaaaaggccaaagagggcaaggtc
gtggcgcgcctcaagggtggcgacccctacatgttcgggcgtggcggtgaagaggccgaa
gaactgctcgacgcgggcgtgcccttcgaggaagtccccggcgtgaccagcgccatcgca
gggcctgcctacgctggtattccgctcacccaccgttcgtatgcctcgtcggtgtcgttc
atcaccgggcacgagaatcccgacaagcccgattcggcgcataactggcaggccctcgcc
gctggtaccagcacgctggtcttcttcatgggcatgaagaacctgcccgacatctcgcgc
aagctcatcgccgcgggcatgtcgcctgacaagcccgccgcgctggtgcgctgggggacg
accccgcgtcaccgcagcctcgtcgccaccatcgccacgttgcccgaagaggccgtgaag
catggcttcagcaatccctcgctcatcgttgtgggtgatgtggtgcgtctgcgcgaccgt
ctcaactggttcgagcacaagcccctgctgggcaagggcgtcgtggtcacgcgcgcccgt
gaacaggccagcggccttgctgcggcgttgcgtgaacttggggccgatgtcatccagttt
cccaccatcgacatccaccccctcgacgattacgccccggtgcatgaggccatccgcgcc
ctcgacacctacgactgggtggtcttcacctcggtcaacggcgtgaagcacttctggaac
cagcttgcggcgctggggctcgacagccgtgccctcggcggacgcaaggtggcagccatc
ggccccgccacggcggatgccctgcgcgacaagggcatcgcccccgacttcatccccgag
aagtacgtcgccgaaggcgtggtcgaagggatgctcgcccgcggtatgggcggcaagcgc
gtgctgctgccccgcgccctcgaagcgcgtgaggtgctgcccgaagaacttcgcaaggcc
ggtgccactgtcgacgtgctgcccgtgtacgtcaccgtgccctctgccgcacgccgtgac
gacgttctggcgcgcatggaggcgggcgaggtgcattgcgtgaccttcggttcgtcgtcc
accgtggagaacttcttctctctggtccctgccgatacggtgaaggcgcaccccgaagtg
aagcttgcctgcatcggcccggtgaccaagaagacgctggagggcttcggcttcacctgc
catatccagcccgacgactacaccatccccgcacttgtcgatgaactgacccgcgtattg
cctgaattgtaa

DBGET integrated database retrieval system