KEGG   Desulfovibrio vulgaris Hildenborough: DVU0900Help
Entry
DVU0900           CDS       T00171                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00230  Purine metabolism
dvu01100  Metabolic pathways
Module
dvu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DVU0900 (gmk)
Enzymes [BR:dvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DVU0900 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 MobB AAA_18 AAA_16 AAA_25 AAA MMR_HSR1 MEDS TsaE IstB_IS21 AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 2794118
NCBI-ProteinID: YP_010121
UniProt: Q72DM9
Position
992426..993049
Genome map
AA seq 207 aa AA seqDB search
MGRERSGIVLVLCAPSGTGKTTLTRRLLTEFPRFAFSVSYTTRKPRNGEVDGKDYHFVTV
EAFLRLRDAGFFAEWAEVHGNFYGTPLKATLDLLDEGRDVLFDIDVQGARQLRASLQRGR
YVFIMPPSRDELEHRLRARGTDDEETIARRLANAAKELREARRFDAWIVNDDLERAYDEL
RAAYIEETLSPECRSAFLDGLLQGWND
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaacgctccggcatcgtgctggtgctgtgcgccccttcggggaccggcaag
accaccctgaccagaaggctgctgacggagtttccgcgtttcgccttctcggtctcctac
accacgcgtaaaccccgcaatggcgaggtggacggcaaggactaccattttgtcaccgtg
gaggcgttcctgcgcctgcgcgacgccggattcttcgccgaatgggccgaagtgcacggc
aacttctacggtacgcccctcaaagccacactcgaccttcttgatgaaggccgcgacgta
ctcttcgacatcgacgtgcaaggtgcgcggcagttgcgtgcaagcctgcaacgcgggcgc
tacgtcttcatcatgccgccatcgcgcgacgaactcgagcacaggctgagggcgcgcggc
accgacgacgaggagaccatagcccgccgtctcgccaacgcggccaaggaactgcgcgag
gcgcgccgcttcgatgcgtggatagtcaacgacgacctcgaacgcgcctacgatgagttg
cgtgccgcctacatcgaggagacgctgtccccggaatgccgttcggcgttccttgacgga
ttgctgcaggggtggaacgactga

DBGET integrated database retrieval system