KEGG   Desulfovibrio vulgaris Hildenborough: DVU0930Help
Entry
DVU0930           CDS       T00171                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00330  Arginine and proline metabolism
dvu00332  Carbapenem biosynthesis
dvu01100  Metabolic pathways
dvu01130  Biosynthesis of antibiotics
dvu01230  Biosynthesis of amino acids
Module
dvu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DVU0930 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    DVU0930 (proB)
Enzymes [BR:dvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DVU0930 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Fibrillarin DUF993
Motif
Other DBs
NCBI-GeneID: 2794630
NCBI-ProteinID: YP_010151
UniProt: Q72DJ9
Position
1019714..1020856
Genome map
AA seq 380 aa AA seqDB search
MEWTEERAAALREARCVVVKVGSAVLTTETGVNLAVIDSLAAQLSALQESGKRVVLVSSG
AVAAGRSALRDCCEIAGMPHKQAASAVGQSRLMHHYDEAFARYGHLSAQVLLTRDDLRNR
ERFLNARNTFQALLDWGVIPVVNENDTVAVQELKFGDNDCLASLLLNVVEGDLYVNLTSA
SGVYADNPQTNPEAGILPCIEDVHTLDLDVMCGGKTSVGTGGMYSKLLAASRAAQLGVPT
LILPGREPRILERAFSGEPVGTWVRPEARVVSRRKYWLAYQSEPSGTVTVDEGAARALLQ
QGGSLLPGGVCDVSGAFEPGALVRIAGPDGTVIAVGLSNYGDRDLVRIKGHRRHEVAAIL
GDAHFPEVVHRDNMLLDAVV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacggaggaacgcgccgcagccctgcgcgaggcgcgttgcgtagtggtcaag
gtgggcagtgccgtgctgaccaccgaaacgggcgtcaatcttgccgtcatcgacagtctc
gccgcccagctttcggccttgcaggaatctggcaagcgggtggtgctcgtctcttcgggt
gctgtggctgccgggcgcagtgccttgcgcgactgctgcgagattgccggaatgccgcat
aagcaggcggcttcggccgtagggcaaagccgtctcatgcatcactatgacgaggcgttc
gcccgttacgggcatctctcggcgcaagtgcttctcacccgggacgacctgcggaaccgt
gagcgttttctcaacgcacgcaacacgttccaggcgcttctcgactggggggtcatcccg
gtcgtcaacgagaacgacaccgtggcggtgcaggaactcaagtttggcgacaacgactgc
cttgccagcctgctgctcaacgtcgtcgagggcgacctgtacgtcaacctcacctccgcg
tcgggtgtctatgccgacaacccgcagaccaatcccgaagccggtatcctgccgtgcatc
gaggacgtgcacacgctcgacctcgatgtgatgtgcggaggcaagacgtctgtcggtacc
ggcggcatgtactccaagctgctggctgcaagccgcgccgcacaactgggggtgccgacg
ctcattcttccggggcgtgaaccgcgcatcctcgaacgtgccttctcgggtgaacccgtg
gggacatgggtgcgccccgaggcacgagtcgtgtcgcgccgcaagtactggctggcgtac
cagtccgaaccttcggggacggtgacggtggacgagggtgcggcccgtgcgctgttgcag
caaggtggaagcctgcttccgggcggcgtctgcgatgtctccggcgcattcgaacccggg
gcgcttgtgcgtatcgccgggccggacggaaccgtcattgccgtgggtttgtcgaattac
ggcgaccgtgaccttgtgcggataaaggggcatcgacgtcacgaggtggctgccattctc
ggtgatgcccatttcccggaagtggtgcaccgcgacaacatgcttctggacgccgtggta
tag

DBGET integrated database retrieval system