KEGG   Desulfovibrio vulgaris Hildenborough: DVU1035Help
Entry
DVU1035           CDS       T00171                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DVU1035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU1035
   00052 Galactose metabolism
    DVU1035
   00500 Starch and sucrose metabolism
    DVU1035
   00520 Amino sugar and nucleotide sugar metabolism
    DVU1035
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DVU1035
   00524 Butirosin and neomycin biosynthesis
    DVU1035
Enzymes [BR:dvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DVU1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
1137931..1138995
Genome map
AA seq 354 aa AA seqDB search
MHRDTVTSFPFVATGMEKGCRILAADIGGTRSRFAYFDYAGGELGMGDVVRIPTAEATGF
DDLLGRVRAAAPGAWARLTRQTDTGNDAPDTPDASVTAFAAFAVAGPVEEGARCLPPNIG
WHIDLATTRGLPCAASLLNDFEAQGWACLLPGAQQCLQLLPGKPDATAPVAVVGAGTGLG
KCLLLPGTPHRVLPSEGGHATFAFEGRAEAEYAAFAADRLGVGRLIGDDVLSGPGLSLLY
AYHHGETLPPHEVAARLTGSDVVVEWFARFYGRTCRDWALHTLARGGVRIAGGVAAANPM
LVQHGAFAEAFFDCPTHTHLLRTIPVSLVTNADAGLWGAAIFALLHAGTRRTPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgacacggtgacaagctttccctttgtcgcgaccggcatggagaagggctgc
cgtatccttgccgcagacatcggcgggacacgcagccgctttgcctacttcgactatgcc
ggaggggagcttggcatgggcgatgtcgtccgcatccccacggcggaggctaccgggttc
gacgacctgcttggcagggtgcgcgcagccgcgcccggtgcatgggcgcgactgacgcga
cagactgacaccgggaatgatgctccggatacgcccgatgcaagcgtcaccgccttcgcc
gcctttgccgtggcagggcctgtcgaggagggggcgcgttgtctgcctcccaacatcggt
tggcatatcgacctcgccaccacgcgtggtttgccgtgtgcagcgtcgctgctcaacgat
ttcgaggcgcagggatgggcctgtctgctgcccggggcgcaacagtgccttcagctactg
cccggaaagccggacgcgacggcacctgtggctgtcgtcggggcaggcacggggcttggc
aaatgccttctgcttccgggcacgccgcacagggtgctgccctcggagggagggcacgcc
acgttcgccttcgaggggcgtgccgaggccgaatacgccgcctttgctgccgaccgcctt
ggcgtgggacgactgattggcgatgacgtgctttccgggcccgggctgtctctgttgtac
gcctatcatcacggcgagacgctacccccgcacgaggtggcggcacgtctcaccggaagt
gacgtcgtcgtcgagtggttcgcgcgtttctacgggcgcacctgccgtgactgggcgttg
catacccttgccagaggcggtgtgcgcatcgcggggggagtggcggctgccaaccccatg
ctggtgcagcatggggccttcgccgaggcgttcttcgattgccccacgcacacgcacctc
ttgcgcaccatccccgtctcactggtcaccaatgccgacgccggcctatggggggcggcc
atctttgccctgcttcatgccgggacaaggagaacgccacgatga

DBGET integrated database retrieval system