KEGG   Desulfovibrio vulgaris Hildenborough: DVU1283Help
Entry
DVU1283           CDS       T00171                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DVU1283 (galU)
   00052 Galactose metabolism
    DVU1283 (galU)
   00500 Starch and sucrose metabolism
    DVU1283 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    DVU1283 (galU)
Enzymes [BR:dvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DVU1283 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375922..1376800
Genome map
AA seq 292 aa AA seqDB search
MPVNIRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQKSGIGDVVFVTNR
DKKIIEDHFDYNLQLESVLERAGKTEMLRQVREVAEMVNIISVRQKKQLGLGHAVLCARE
IVRDEPFAVMVGDDLMFGMTPGIQQLIDVAVAEHLPVIGVMEVPADKVSRYGIIAGEETA
PGIYKVSRLVEKPSIAEAPSRLAIVGRYVLTPDIFDSLEKVKPGHGGEIQLTDALQNLAD
DRGLLAVKIRGMRFDAGDWAEYLTANIYFALQEEGLRDDLISQLRPLLPFRC
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgaacatacgcaaggtggtcattcctgtcgcagggtggggcactcggtcgctt
ccggcgaccaagaacatccccaaggagatgctcccggtctacaacaagcctgtggtacag
tatgtcgtagaagaggcgcaaaagtccggtattggcgatgtcgtcttcgtcaccaaccgg
gacaagaagatcatcgaggaccacttcgactacaacctccagcttgaatccgttctcgag
cgtgccggcaagaccgaaatgctccggcaggtgcgcgaggtcgccgagatggtgaacatc
atctcggtgcgccagaagaagcagcttggccttgggcatgccgttctttgcgcacgtgag
atcgtccgggatgaaccctttgccgtcatggtgggtgacgacctgatgttcggcatgacg
ccgggtatccagcaactcatcgatgtggctgtggcagagcacttgcctgtcatcggggtc
atggaggttccggccgacaaggtctcgcgttacggcatcattgcgggcgaggagacggcc
ccgggcatctacaaggtttcccgcctcgtcgagaagccgagcatcgctgaagcaccctca
cgcctcgccatcgtggggcgctatgtcctcacgccggatatcttcgacagccttgaaaag
gtgaaacccggacatggtggcgagattcagctcaccgatgcgttgcagaaccttgccgat
gacagggggctgcttgccgtcaagattcggggcatgcgtttcgacgcaggcgactgggcc
gaatatctcacggccaatatctatttcgcacttcaggaagaaggcttgcgcgacgacctc
ataagtcagttgcgacctctcctgcctttccgttgttga

DBGET integrated database retrieval system