KEGG   Desulfovibrio vulgaris Hildenborough: DVU1530Help
Entry
DVU1530           CDS       T00171                                 

Definition
metallo-beta-lactamase
Orthology
K07576  
metallo-beta-lactamase family protein
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1598015..1599625
Genome map
AA seq 536 aa AA seqDB search
MKVQFLGAAQTVTGSCYMIEANGVRFAIDCGMHQGNTEIEKRNDDTEIYRPSDIAFFLVT
HAHIDHTGLLPAMTRNGFTGPIYCTEPTADLLGIMLQDSAHIQEMEAEWQSRKLSRNGRI
KKVEPLYTTEDATRAAEMLRPVDYGNSFEPSPGIRVTYKDAGHILGSAFLELEVTENGRP
TRLVFSGDLGRPDALIVNDPQKAAPADYLFLESTYGDRDHKDPRFSRDELAEAIAYSYGN
GEKVIIPAFAVERTQEVLYTLYLLHKEGRLPADMPVFVDSPLAIRATEIFRKHPKYYDDN
MKKLVDSGEDPLALPNLKYTLNTQDSQALNVRSGPAVIISASGMCNAGRIKHHLRHNLWR
PGASIVFVGYQGVGTPGRKIVDGNATVRLFNEDIAVKAKVFTIGSFSAHAGQSQILEWVS
AFAHPQMEVFLVHGEEKAQTTLAGLLRERFNLPVSIPGYLEEVTLKPGRESLHQTDEARA
HPDVDWEFLLAETEGKVAQLRKRLAGVEKRPWVEQTDIRERLVEINGELLHFLSQL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccagtttcttggagctgcccagacggtgaccggctcctgctacatgatagag
gccaacggtgttcgcttcgccatcgactgcggcatgcatcagggcaacaccgaaatcgaa
aagcgtaacgatgataccgagatctatcgtccatccgacatagccttctttctggtcacc
cacgcgcatatcgaccatacggggctgctgcccgccatgacgcgcaacgggttcaccggc
cccatatactgcacagaacccacagccgacctgcttggcatcatgttgcaggacagcgcg
cacatccaggagatggaagcggaatggcaaagccgcaaactctcccgcaacgggcgcatc
aagaaggtcgaaccgctctatacgaccgaagacgccacccgggcggccgagatgctgcgt
ccggtggactatggcaactcgttcgaaccttcgcccggcatccgtgtgacatacaaggac
gcggggcacatcctcggttcggcgttcctcgaacttgaagtcacggaaaacggcagaccc
acacggctcgtcttttcgggcgacctcggcaggcccgacgccctcatcgtcaacgacccg
cagaaggccgccccggcggactatctctttctcgagtccacctatggcgaccgtgaccac
aaagacccacgcttcagccgcgacgaactggctgaagccatcgcctacagctacggcaat
ggcgaaaaggtcatcattcccgccttcgccgtcgaacgcacgcaggaagtgctctacact
ctctacctgctgcacaaggaaggcagactgcctgccgacatgcccgtcttcgtggatagc
ccgctggccataagagctaccgagatattccgcaagcatccgaaatattatgatgataat
atgaagaagcttgtagattcgggcgaagacccgctggcgctgcccaacctgaaatacacg
ctcaatacgcaggattcgcaggccctcaacgtgcggtctggcccggctgtcatcatctcc
gccagcggcatgtgcaatgcagggcgcatcaagcaccacctgcggcacaacctgtggcgg
cccggtgccagcatcgtcttcgtgggctatcagggcgtaggcacacccggccgcaagatt
gtcgacggcaatgccacggtgcgcctgttcaacgaagacatcgccgtcaaggccaaggtc
ttcaccatcggcagcttctcggcacatgcgggccagagtcagattctggaatgggtgtcg
gctttcgcccatccccagatggaggtattcctcgtccacggcgaagagaaggcacagacg
acgcttgccggactgttgcgcgagcgtttcaaccttccggtgtccatacccggctatctt
gaagaggtcacgctcaagccggggcgcgagtcgttgcaccagaccgacgaggcacgggca
catcccgacgtcgactgggaattcctgcttgccgagactgagggcaaggtggcacaactc
cgcaagcgtctcgcgggcgtggagaagcggccttgggtcgaacagaccgacatccgcgaa
cgcctcgtcgagatcaacggcgaactgttgcatttcctttcgcagttgtag

DBGET integrated database retrieval system