KEGG   Desulfovibrio vulgaris Hildenborough: DVU1677Help
Entry
DVU1677           CDS       T00171                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DVU1677 (tpiA)
   01230 Biosynthesis of amino acids
    DVU1677 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU1677 (tpiA)
   00051 Fructose and mannose metabolism
    DVU1677 (tpiA)
   00562 Inositol phosphate metabolism
    DVU1677 (tpiA)
Enzymes [BR:dvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DVU1677 (tpiA)
Exosome [BR:dvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DVU1677 (tpiA)
  Exosomal proteins of bladder cancer cells
   DVU1677 (tpiA)
  Exosomal proteins of melanoma cells
   DVU1677 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1756281..1757036)
Genome map
AA seq 251 aa AA seqDB search
MKKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVLVCPPFTALHALHDTFKDVEG
FAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLK
AGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGKV
AGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL
QAVSFSRIILA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcatcgccgccaattggaaaatgtacaagaccatcgacgaggctagggct
acgggacgcgaacttgtgtccgccgtcgccgggtcactgcccgcagaccgtgaggtgctc
gtgtgcccccccttcacggcgctccatgcccttcatgacaccttcaaggacgtcgagggg
tttgccatcggcgggcaggatgtctacccggctaccgaaggggcctacaccggcgaaatc
gcacccggcatgttgctcgatgccggatgcggatgggtgctcaccgggcactctgaacgg
cgtcatattctcggtgaggacgacgagacggtcgcgcgcaagacggctttcagcctgaag
gccggactgcgtgtggtactgtgcatcggcgaaaagcttgatgaacgtgaggctggcagg
cttgaagacgtgctggcgcatcagctgcaggtcgggcttgcagatgtcgacgcgacctat
gtaccccagtcgcttgtggtggcctacgaacccgtatgggctatcggtacgggcaaggtg
gcggggcctgccgaagtcgtcgaggctcacgctcttgtccgttcgctactcgaagcccgt
tacggtcgcgacggtgccgccatacgcatcctgtacgggggcagcgtgaagcctgacaac
gccgcagaactactttctcttgacaatgtcgacggtctgctggtaggaggcgcttctttg
caggctgtcagcttcagccgcatcattctggcatga

DBGET integrated database retrieval system