KEGG   Desulfovibrio vulgaris Hildenborough: DVU1824Help
Entry
DVU1824           CDS       T00171                                 

Definition
(RefSeq) hypothetical protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
Enzymes [BR:dvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     DVU1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 Abhydrolase_1 Thioesterase Esterase Asp2 PGAP1 UPF0227 Abhydrolase_2 DUF1057
Motif
Other DBs
NCBI-GeneID: 2793485
NCBI-ProteinID: YP_011042
UniProt: Q72B15
Position
complement(1889515..1890279)
Genome map
AA seq 254 aa AA seqDB search
MTGGACLLIHGFGGAPFEMEPLAVALSEAGVEAHVITLPGHDATLEDFEATCFDDWARHA
DECYRDLEARAGRVVVVGLSMGGTLALHLGCRFRPAGVVALAAPVFLYRAVPFVMQDWRL
PFVGLLKRVRRRWPVPCRKPEATAVAPWRGYDGVMALPQLHSLIKGMGQVERELPLLVAP
LLLMHARGDRTVPVENALHIARRVTSDDVCVRLFGLADRVAGHHLITTHRESRSFVAREV
VSFTQRALSQNCKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaggggcatgtctgctcattcacggtttcggcggggcgccgttcgagatggaa
ccgctggccgttgcgttgtccgaggccggggtcgaggcacacgtcatcaccctgcccggg
catgatgcgacacttgaagatttcgaggccacctgtttcgacgactgggcgcgccatgcc
gacgagtgctaccgggaccttgaggcacgcgctgggcgcgttgtggtcgtcggtctttcc
atgggcggaacgcttgccctgcacctgggctgccgcttccggcccgccggggttgtcgcc
cttgccgcgcctgtcttcctgtaccgtgccgtaccgttcgtcatgcaggactggcgccta
cccttcgtagggttgctcaagcgggtgcggcgtcgatggcctgtgccgtgtcgcaagccc
gaggccacagccgtggcgccgtggcgcggttatgacggggtcatggccttgccgcagctg
cacagcctcatcaaggggatggggcaggttgagcgggagttgccactgctggtggccccg
cttcttctgatgcacgcccgcggcgaccgtaccgtgcctgtggagaatgcccttcacatc
gcccgacgcgtgacgtcggatgatgtctgtgtacggttgttcgggctcgccgacagggtg
gcagggcatcatctcatcacgacccatcgcgagagtcggagctttgtcgctcgtgaggtc
gtttcgtttacgcaaagagcattgtctcaaaattgtaaaaaatag

DBGET integrated database retrieval system