KEGG   Desulfovibrio vulgaris Hildenborough: DVU1827Help
Entry
DVU1827           CDS       T00171                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dvu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1892330..1893553
Genome map
AA seq 407 aa AA seqDB search
MSSQLLSRLDNLRDRVIELQRNMTALPALGPESGGEGERAKADYLLSVLRDMGMPLIEEI
DAPDPRVPCGHRPNIAARIPGRTGRTLWVIGHMDVVPPGEAALWDTDPWQLKVDGDIIFG
RGVEDNQQGIVTGLLVAQELLASGTVPDMGFGLLLVADEETGNNYGMAHVATARPDLFGD
DDLVIVPDFGTEDGAMIEIAEKSMLWLKVQVAGKQCHASTPDEGINSLVAASAMILRVHE
LDARFDAVDPLFNPPASTFVPTKKEANVPNVNTVPGNDVFYIDCRVLPCYLLTDVRQAVR
EIADDIERAYGVTVTLSDVQAEQAAPATSSDSDVVHRLTRAIRAEYGVEARPMGVGGGTV
GAILRKRGLPVAVWSTLVPNPHTPNEASRISRTIGDAKVVARMLFDA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaactcctctcccgcctcgacaacctgcgtgacagggtcatcgaactccag
cgcaacatgacggccctgcccgccctcggccccgaaagcggcggcgaaggcgaacgcgcc
aaggccgactatcttctttccgtcctgcgtgacatgggaatgcccctcatcgaggagata
gacgcccccgacccgcgtgtcccctgcggtcacaggccgaacatcgcggcacgcataccc
ggccgtacggggcgcaccctgtgggtcataggccatatggatgtcgtgccccccggcgag
gcggccctgtgggataccgacccgtggcaactcaaggtcgatggcgacatcatcttcggg
cgcggcgtcgaggacaaccagcaaggcatcgtcaccggcctgctggtggcacaggaactt
cttgcctccggcacggtgcccgacatgggtttcggccttctcctcgtcgccgatgaggag
actggcaacaactacggcatggcgcatgtcgccacggcccgccccgaccttttcggcgac
gacgaccttgtcatcgtgcccgacttcggcaccgaagacggcgcgatgatcgaaatcgcg
gaaaagagcatgctctggctcaaagtgcaggttgcaggcaaacagtgccatgcgtccaca
cccgacgagggcatcaactcgctggttgccgcctctgccatgatactgcgcgtgcatgag
cttgacgcgcgtttcgatgcggtagacccgcttttcaacccgcccgcctccaccttcgtc
cccacgaagaaggaagccaacgtgcccaacgtcaacacggtccccggtaacgatgtgttc
tacatcgactgccgtgtcctgccctgctacctactcaccgatgtgcggcaggccgtacgg
gaaatcgccgacgatatcgaacgggcctacggtgtcaccgtgactctctccgatgtacag
gccgaacaggccgcgcccgcgacctcctccgacagcgacgtcgtgcatcgcctgacccgt
gccatccgtgccgaatacggcgtggaagcccgccccatgggcgtgggcggaggcacagtg
ggcgccatcctgcgcaagcggggactccctgtggccgtatggtcgacgctcgtacccaat
cctcacactcccaacgaggcttcacgcatctcgcgcaccatcggtgacgccaaggtcgtc
gcccgtatgctcttcgacgcctga

DBGET integrated database retrieval system