KEGG   Desulfovibrio vulgaris Hildenborough: DVU1827Help
Entry
DVU1827           CDS       T00171                                 

Definition
(RefSeq) diaminopimelate aminotransferase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00300  Lysine biosynthesis
dvu01100  Metabolic pathways
dvu01120  Microbial metabolism in diverse environments
dvu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    DVU1827
Enzymes [BR:dvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DVU1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 HSBP1 Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 2793488
NCBI-ProteinID: YP_011045
UniProt: Q72B12
Position
1892330..1893553
Genome map
AA seq 407 aa AA seqDB search
MSSQLLSRLDNLRDRVIELQRNMTALPALGPESGGEGERAKADYLLSVLRDMGMPLIEEI
DAPDPRVPCGHRPNIAARIPGRTGRTLWVIGHMDVVPPGEAALWDTDPWQLKVDGDIIFG
RGVEDNQQGIVTGLLVAQELLASGTVPDMGFGLLLVADEETGNNYGMAHVATARPDLFGD
DDLVIVPDFGTEDGAMIEIAEKSMLWLKVQVAGKQCHASTPDEGINSLVAASAMILRVHE
LDARFDAVDPLFNPPASTFVPTKKEANVPNVNTVPGNDVFYIDCRVLPCYLLTDVRQAVR
EIADDIERAYGVTVTLSDVQAEQAAPATSSDSDVVHRLTRAIRAEYGVEARPMGVGGGTV
GAILRKRGLPVAVWSTLVPNPHTPNEASRISRTIGDAKVVARMLFDA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaactcctctcccgcctcgacaacctgcgtgacagggtcatcgaactccag
cgcaacatgacggccctgcccgccctcggccccgaaagcggcggcgaaggcgaacgcgcc
aaggccgactatcttctttccgtcctgcgtgacatgggaatgcccctcatcgaggagata
gacgcccccgacccgcgtgtcccctgcggtcacaggccgaacatcgcggcacgcataccc
ggccgtacggggcgcaccctgtgggtcataggccatatggatgtcgtgccccccggcgag
gcggccctgtgggataccgacccgtggcaactcaaggtcgatggcgacatcatcttcggg
cgcggcgtcgaggacaaccagcaaggcatcgtcaccggcctgctggtggcacaggaactt
cttgcctccggcacggtgcccgacatgggtttcggccttctcctcgtcgccgatgaggag
actggcaacaactacggcatggcgcatgtcgccacggcccgccccgaccttttcggcgac
gacgaccttgtcatcgtgcccgacttcggcaccgaagacggcgcgatgatcgaaatcgcg
gaaaagagcatgctctggctcaaagtgcaggttgcaggcaaacagtgccatgcgtccaca
cccgacgagggcatcaactcgctggttgccgcctctgccatgatactgcgcgtgcatgag
cttgacgcgcgtttcgatgcggtagacccgcttttcaacccgcccgcctccaccttcgtc
cccacgaagaaggaagccaacgtgcccaacgtcaacacggtccccggtaacgatgtgttc
tacatcgactgccgtgtcctgccctgctacctactcaccgatgtgcggcaggccgtacgg
gaaatcgccgacgatatcgaacgggcctacggtgtcaccgtgactctctccgatgtacag
gccgaacaggccgcgcccgcgacctcctccgacagcgacgtcgtgcatcgcctgacccgt
gccatccgtgccgaatacggcgtggaagcccgccccatgggcgtgggcggaggcacagtg
ggcgccatcctgcgcaagcggggactccctgtggccgtatggtcgacgctcgtacccaat
cctcacactcccaacgaggcttcacgcatctcgcgcaccatcggtgacgccaaggtcgtc
gcccgtatgctcttcgacgcctga

DBGET integrated database retrieval system