KEGG   Desulfovibrio vulgaris Hildenborough: DVU1925Help
Entry
DVU1925           CDS       T00171                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dvu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1998495..1999136
Genome map
AA seq 213 aa AA seqDB search
MHRTCLLLALGDSLTEGYGLPPGRAMPDVLQEMLRDAGLPVTCLNLGLSGDTSAGGLRRL
RAWLARNAEKFQAHATGTAPIVAIVELGANDSFIGIEPDEVAANLDAILSLLAGHGIPAL
LMGWQATMADTPDYADDFEDLYADLAAKHGTPLYADTLAGIWGEDRMTLHDGLHPSIEGV
RHMATSILPLVRTLVETALAGEDHATPPCPPRH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcacctgcctcctgcttgccctcggtgacagcctcaccgagggttacggtctg
ccgccgggccgcgccatgcctgacgtgctgcaggagatgctccgcgacgccggtctgccc
gtgacatgcctcaaccttggcctctcgggcgacacttcggcaggcggactgcgccgtctt
cgggcatggctggcacgcaatgccgagaagtttcaggcacacgcgacgggaacagcaccc
atcgtcgccatcgtggaattgggggccaacgacagtttcatcggcatcgaaccggatgag
gtcgccgcgaatctcgacgccatcctctctctgcttgccggtcacggcattcccgcgctg
ctcatgggatggcaggcgaccatggcggacacccccgactacgccgatgacttcgaagac
ctgtacgccgaccttgcggcgaagcatggcacgcctctctatgctgacacgcttgccggt
atctggggtgaagacaggatgaccctgcatgacgggctgcatccctctatcgagggggta
cgccacatggctacgtcgatactgccccttgtccgcacgcttgtcgaaaccgccctcgct
ggcgaagaccacgccacgccgccatgccccccacgacactga

DBGET integrated database retrieval system