KEGG   Desulfovibrio vulgaris Hildenborough: DVU1925Help
Entry
DVU1925           CDS       T00171                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DVU1925
Enzymes [BR:dvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DVU1925
   3.1.2  Thioester hydrolases
    3.1.2.-  
     DVU1925
Lipid biosynthesis proteins [BR:dvu01004]
 Fatty acid synthase
  Component type
   DVU1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998495..1999136
Genome map
AA seq 213 aa AA seqDB search
MHRTCLLLALGDSLTEGYGLPPGRAMPDVLQEMLRDAGLPVTCLNLGLSGDTSAGGLRRL
RAWLARNAEKFQAHATGTAPIVAIVELGANDSFIGIEPDEVAANLDAILSLLAGHGIPAL
LMGWQATMADTPDYADDFEDLYADLAAKHGTPLYADTLAGIWGEDRMTLHDGLHPSIEGV
RHMATSILPLVRTLVETALAGEDHATPPCPPRH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcacctgcctcctgcttgccctcggtgacagcctcaccgagggttacggtctg
ccgccgggccgcgccatgcctgacgtgctgcaggagatgctccgcgacgccggtctgccc
gtgacatgcctcaaccttggcctctcgggcgacacttcggcaggcggactgcgccgtctt
cgggcatggctggcacgcaatgccgagaagtttcaggcacacgcgacgggaacagcaccc
atcgtcgccatcgtggaattgggggccaacgacagtttcatcggcatcgaaccggatgag
gtcgccgcgaatctcgacgccatcctctctctgcttgccggtcacggcattcccgcgctg
ctcatgggatggcaggcgaccatggcggacacccccgactacgccgatgacttcgaagac
ctgtacgccgaccttgcggcgaagcatggcacgcctctctatgctgacacgcttgccggt
atctggggtgaagacaggatgaccctgcatgacgggctgcatccctctatcgagggggta
cgccacatggctacgtcgatactgccccttgtccgcacgcttgtcgaaaccgccctcgct
ggcgaagaccacgccacgccgccatgccccccacgacactga

DBGET integrated database retrieval system