KEGG   Desulfovibrio vulgaris Hildenborough: DVU2256Help
Entry
DVU2256           CDS       T00171                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DVU2256 (ruvA)
Enzymes [BR:dvu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DVU2256 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2351230..2351838)
Genome map
AA seq 202 aa AA seqDB search
MIAYVEGRLAEVAGNACVVVTDGGVGYEVFVPGHTLARLPDKGGRVSFFISTEVREDALE
LYGFATWDERQTFIVLTSISKVGAKTGLAILSQFRPDDLRRLVVEDDVLALTRVSGIGKK
TAQHIFLELKYKLKVEDLPAAAPLVTGGAPGGVFRDALAGLANLGYGEEEASHVLKDVLH
GEPDLDVGGALRAALRALARGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgtatgtcgaaggccgtctggccgaagtcgcgggcaacgcctgtgtcgtcgtc
accgacggcggggtggggtacgaggtcttcgtgccggggcacacgcttgcgcgtcttccc
gacaagggggggcgggtcagcttcttcatcagcaccgaagtgcgcgaagatgcgcttgaa
ctctacggcttcgccacatgggacgagcggcagacgttcatcgtgctcacgtccatctcc
aaggtcggtgccaagaccgggcttgccatcctctcgcaattcaggccggacgacctgcgg
cgtttggtggttgaagacgatgtgctggcactcactcgcgtctccggcatcggcaagaag
acggcgcagcatatctttctcgaactcaagtacaagctcaaggtcgaggacctgcccgca
gccgcgccccttgtcacgggcggtgcccccggcggtgtcttccgcgacgcgctggcgggt
cttgcgaacctcggctacggcgaggaagaggcctcacacgtgctcaaggatgtgctccac
ggcgagccggacctcgacgtggggggcgcgttgcgcgccgcattgcgcgctctggcgagg
ggacgctag

DBGET integrated database retrieval system