KEGG   Desulfovibrio vulgaris Hildenborough: DVU2499Help
Entry
DVU2499           CDS       T00171                                 

Gene name
ftsZ
Definition
(RefSeq) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Brite
Chromosome and associated proteins [BR:dvu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    DVU2499 (ftsZ)
Cytoskeleton proteins [BR:dvu04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   DVU2499 (ftsZ)
Prokaryotic defense system [BR:dvu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    DVU2499 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2 TFIIA
Motif
Other DBs
NCBI-GeneID: 2795467
NCBI-ProteinID: YP_011711
UniProt: Q728V3
Position
complement(2609897..2611246)
Genome map
AA seq 449 aa AA seqDB search
MEFMDIDIENSAKIKVIGVGGGGGNAVQNMITSTLKGVTFICANTDVQALGRSSAELKIQ
LGEKLTKGLGAGANPQIGRDAAVESMNAIKDCIGEADMVFVTAGMGGGTGTGAAPVIAQA
AREMGALTVGVVTKPFFFEGRKRLEAAEQGIADFREHVDSLITIPNDRLLSLAPKKATFV
EMLKKADEVLYFAVKGISDLIMVPGLINLDFADVKAVMGESGLAMMGAGIARGESRAREA
AMKAITSPLLEDVSIDGARGVLMNITCGPDLTIDEVSEAAGIIQEAAHDEARIFFGTVFD
ESAGDEMRITVIATGIEACGSATVTPNAQNGNIAQFRRPSQQQAAPAAQRPAPQARVESG
PVAEFGRQQPQQAPQQPQQAPQQAQQVAPGRGLSNFSDEDRNIPAYLRKQTRNPSGISRS
NGGHVPGEDDFIFDEDEFELPTFIRKQAD
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaattcatggatatcgacatcgagaactccgccaagatcaaggtcataggcgtaggt
ggcggcggcggcaacgccgtgcagaacatgatcacctccacgctcaagggcgtgaccttc
atctgcgcgaacaccgacgtgcaggcccttggccgttcttcggcggaactcaagatacag
cttggcgaaaaactcaccaagggcctcggcgccggtgccaatccgcaaataggtcgtgac
gctgccgtcgagagcatgaacgcgatcaaggattgcatcggtgaagccgacatggtgttc
gtcaccgcaggcatgggtggcggcaccggtaccggtgcagcccctgtcatcgcgcaggcc
gcccgcgagatgggcgcgctcaccgtgggtgtggtgaccaagcccttcttcttcgaaggc
cgcaagcgccttgaagccgcggaacagggcattgccgacttccgcgagcatgtggacagc
ctcatcaccatccccaacgacaggctgctttcgctggcccccaagaaggccaccttcgtg
gaaatgctcaagaaggctgacgaagtgctctacttcgccgtcaagggcatctccgacctc
atcatggtgcccggcctcatcaacctcgacttcgccgacgtgaaggccgtcatgggcgag
tcgggtcttgccatgatgggcgcaggcatcgcccgtggcgagtcgcgtgcccgcgaggcc
gccatgaaggccatcaccagcccgctgcttgaagacgtctccatcgacggtgcacgtggt
gtgctcatgaacatcacctgcggtcccgacctcaccatcgacgaagtcagcgaagccgca
ggcatcattcaggaagccgcacacgatgaggcgcgcatcttcttcggtacggtcttcgac
gagtcggctggcgatgagatgcgcatcaccgtcatcgccaccggcatcgaagcctgtggt
tcggccaccgtcacacccaacgcacagaacggcaacatcgcccagttccgtcgtccttcg
cagcagcaggcggcacccgccgcacagcgccctgcaccgcaggcccgtgtcgagtccggc
cccgtagccgaattcgggcgtcagcagccgcagcaggccccgcagcagccgcagcaggct
ccccagcaggcacagcaggtcgcgccggggcgcgggttgtccaacttctctgatgaagac
aggaacatccccgcatacctgcgcaaacagacccgcaatccttccggcatcagccgttcc
aatggagggcacgtgccgggggaggatgatttcattttcgacgaggacgagttcgaactg
cccacgttcattcgcaagcaggccgactag

DBGET integrated database retrieval system