KEGG   Desulfovibrio vulgaris Hildenborough: DVU2901Help
Entry
DVU2901           CDS       T00171                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dvu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dvu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3000393..3001346
Genome map
AA seq 317 aa AA seqDB search
MQNETRSLWPHKDLLDVDQLSKDELLHLLDTAAQFHEINRRPVKKVPTLKGKSVILFFAE
PSTRTKTSFDVAGKRLSADTFSLAKSGSSLQKGESLKDTALTLEAMNPDVLVIRHSSSGA
ARFLAERLACGVVNAGDGWHAHPTQALLDCYSLRQVWGDTFEGRTLCILGDIAHSRVARS
NVKLLTSLGVRVRLCAPRTLLPAGVGNWPVEVFTDLDAAVRDADAVMCLRLQLERQQAGL
LPDLREYSNRYCLTPRRLELAKPEAKVLHPGPMNRGLEIASSIADAPASLVLDQVAAGVA
TRMAILFLLATRTDGGR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgagacccgtagcctatggccccacaaggacctgctggacgtggaccagctc
tcgaaggacgagcttctccacctcctcgacacggcggcacagttccacgagatcaaccgc
cgtccggtcaagaaggtgcccacactcaagggcaagagcgtcatcctcttcttcgccgaa
cccagcacacgcaccaagacctcgttcgacgtggcgggcaagcgtctgtcggccgacacc
ttctcgctcgccaagagcgggtcgagcctccagaagggcgagagcctgaaggacacggcg
ctcacgctcgaagccatgaaccccgacgtgctggtcatccgccactcgtccagcggggcg
gcgcgctttctcgccgaacggctggcctgcggcgtggtcaacgcgggcgacggctggcac
gcacaccccacacaggcgctgctcgactgctattcgctgcgtcaggtatggggcgacacc
ttcgagggacgcacgctgtgcatcctcggcgacatcgcccatagccgcgtggcacgatcc
aacgtgaagctgctcacctcgctgggtgtgcgcgtgcgactgtgcgccccgcgcaccctt
ctgcccgcgggcgtgggcaactggcccgtggaggtgttcaccgacctcgatgccgccgtg
cgcgacgccgacgcggtcatgtgcctgcgcctgcaactggaacgccagcaggcgggactt
ctgcccgacctgcgcgaatactccaaccgctactgcctcaccccgcgccgcctcgaactg
gcgaagccggaggccaaggtgctgcaccccggccccatgaatcgcggactcgaaatcgcc
tcgtccatcgcagacgcccccgccagcctcgtcctcgaccaggtcgccgccggggtcgcc
acgcgcatggccatcctcttccttctcgcaacccgaacggacggaggccgctga

DBGET integrated database retrieval system