KEGG   Desulfovibrio vulgaris Hildenborough: DVU2905Help
Entry
DVU2905           CDS       T00171                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DVU2905
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU2905
  Lipid metabolism
   00071 Fatty acid degradation
    DVU2905
  Amino acid metabolism
   00350 Tyrosine metabolism
    DVU2905
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DVU2905
   00626 Naphthalene degradation
    DVU2905
Enzymes [BR:dvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DVU2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3006122..3007300)
Genome map
AA seq 392 aa AA seqDB search
MKDFVYHNPTEVRFGRGVVASLGARVRAAGLSAVVVVAGGGAARRCGAFGDAVTSLEAAG
VAWTPCEGVRPNPDLDGVLRAVQALRDAGAGGFVAVGGGSVMDTAKAAGVCALHDGDPWD
HFTRRTTATAAVPVFTVPTLSGTGAEMNGTAVITNMAQQRKWSLRGPTPVAAFLDPVYQR
DVPLALAVGCAVDAMTHVLEFAVAGTPCVDAKALDIPGGTYFMEETVLAQNEALLRSIIR
SVEVLRRIPGDYAARASLAWAAGLGLCGLTGVGLGGGSWVSHALEHAVSGHFPQVPHGPA
LAVLFPCWMEEVASEHTPMFERLARNVWGVEGAVEGIRAMRATFDRWGAPRRLAAWGVGE
DAIPGLVRAALEYPRPLGLAPERVERIFRSAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttcgtctatcataacccaacggaagtacgtttcggtcggggcgtggtcgcg
tctctcggggcacgtgttcgcgccgcgggactttcggccgttgtcgtcgtcgcggggggc
ggtgctgcccgtcgttgcggcgcattcggcgatgcggtgacctctctggaggcggcgggc
gtagcatggacaccgtgcgagggggtgcgtcccaaccccgacctcgacggcgtattgcgt
gccgtacaggcgttgcgtgatgcgggggccgggggcttcgtcgccgtgggcggcggcagc
gtcatggataccgccaaggctgcgggtgtatgcgccctgcatgacggagacccgtgggac
cacttcacccgtcgcaccacggcgaccgcggcggtgccggtgttcaccgtgcccaccctg
tcagggacgggggcggagatgaacggcacggccgtcatcaccaacatggcgcagcagcgc
aaatggtcgctgcgtggccccacgccggtggcggcgttcctcgacccggtctatcagcgt
gacgtacccctcgcgctggcggtgggctgcgccgtggacgccatgacgcacgtgctggaa
ttcgcggtggcgggaaccccctgcgtggatgcgaaggccctcgatatccccggtgggacg
tatttcatggaagagacggtgctggcgcagaacgaggcgcttctccgttccatcatccgg
tcggtggaggtgttgcgccgcatacccggtgactatgcggcgcgggcgtcgctggcgtgg
gctgcgggccttggcctgtgcgggctgaccggggtggggcttggcggcggttcgtgggtc
tcgcatgccctcgaacatgcggtgagcgggcatttcccgcaggtgccccacggccctgcg
ctggcggtgctcttcccctgctggatggaggaggtcgcatcggagcacactccgatgttc
gagcgcctcgcacggaacgtgtggggcgtggaaggcgctgtggagggcatccgtgccatg
cgcgccaccttcgaccgctggggtgccccgcgccgtctggccgcatggggcgtgggcgag
gacgccatccccggtctcgtccgtgccgcgctggagtacccccgtccgctcggccttgcc
ccggaacgggtggagcgcatcttcaggagcgccctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system