KEGG   Desulfovibrio vulgaris Hildenborough: DVU2935Help
Entry
DVU2935           CDS       T00171                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DVU2935 (gpmA)
   01230 Biosynthesis of amino acids
    DVU2935 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU2935 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DVU2935 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVU2935 (gpmA)
Enzymes [BR:dvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DVU2935 (gpmA)
Exosome [BR:dvu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DVU2935 (gpmA)
  Exosomal proteins of melanoma cells
   DVU2935 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3040354..3041106
Genome map
AA seq 250 aa AA seqDB search
MARLILLRHGQSAWNLENRFTGWTDVDLSPAGEAEALAAARLIRDEGLDFSVCHTSMLTR
AIRTLHLVQQELDRLWTPVRKHWRLNERHYGALQGLDKRETAARHGEDQVFVWRRSYDVP
PPVIAPDDPKHPVHDPRYADVPPDVLPCGESLEATVARVLPYWYDAIAPDLMAGRDVLVA
AHGNSLRALVMHLDGLDREDVSRLDIPTGLPRLYELDAALRPVSYRYLGDPAEAEERARA
VAAQGRLEKN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcatccttctcagacacgggcagagtgcatggaaccttgaaaaccgcttc
accgggtggacggacgtagacctctccccggcaggcgaagccgaggcactggccgcggca
cggctcatccgggatgaagggctcgacttctccgtgtgccacacctccatgctgacccgt
gccatacgcacgctgcatcttgtacagcaagaactggacaggctctggacgcccgtacgc
aagcactggcgtctcaatgaacggcactacggggccctgcaggggctggacaaacgcgag
accgcggcacgacacggcgaagaccaggtcttcgtctggcggcgcagctacgatgtgccg
ccgcccgtcatcgcccccgacgacccgaagcaccccgtccacgacccccgctacgccgat
gtgccccctgatgtccttccctgtggcgaaagccttgaagcgaccgtggcgcgggtactc
ccctactggtacgacgccatcgcccccgacctcatggcggggcgcgatgtgctggtggcg
gcccacggcaacagcctgcgcgcccttgtcatgcatcttgacgggcttgaccgcgaggat
gtttcacgcctcgacatccccaccgggctgccccgcctgtacgaactggatgccgcactg
cgccccgtgtcgtaccgctatctgggagacccggcagaggctgaggaacgggcacgcgcc
gtagccgcgcaggggcggctcgaaaagaactga

DBGET integrated database retrieval system