KEGG   Desulfovibrio vulgaris Hildenborough: DVU2935Help
Entry
DVU2935           CDS       T00171                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00010  Glycolysis / Gluconeogenesis
dvu00260  Glycine, serine and threonine metabolism
dvu00680  Methane metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
dvu01130  Biosynthesis of antibiotics
dvu01200  Carbon metabolism
dvu01230  Biosynthesis of amino acids
Module
dvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dvu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU2935 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    DVU2935 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVU2935 (gpmA)
Enzymes [BR:dvu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DVU2935 (gpmA)
Membrane trafficking [BR:dvu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DVU2935 (gpmA)
Exosome [BR:dvu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DVU2935 (gpmA)
  Exosomal proteins of melanoma cells
   DVU2935 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4460
Motif
Other DBs
NCBI-GeneID: 2793973
NCBI-ProteinID: YP_012147
UniProt: Q727C0
Position
3040354..3041106
Genome map
AA seq 250 aa AA seqDB search
MARLILLRHGQSAWNLENRFTGWTDVDLSPAGEAEALAAARLIRDEGLDFSVCHTSMLTR
AIRTLHLVQQELDRLWTPVRKHWRLNERHYGALQGLDKRETAARHGEDQVFVWRRSYDVP
PPVIAPDDPKHPVHDPRYADVPPDVLPCGESLEATVARVLPYWYDAIAPDLMAGRDVLVA
AHGNSLRALVMHLDGLDREDVSRLDIPTGLPRLYELDAALRPVSYRYLGDPAEAEERARA
VAAQGRLEKN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcatccttctcagacacgggcagagtgcatggaaccttgaaaaccgcttc
accgggtggacggacgtagacctctccccggcaggcgaagccgaggcactggccgcggca
cggctcatccgggatgaagggctcgacttctccgtgtgccacacctccatgctgacccgt
gccatacgcacgctgcatcttgtacagcaagaactggacaggctctggacgcccgtacgc
aagcactggcgtctcaatgaacggcactacggggccctgcaggggctggacaaacgcgag
accgcggcacgacacggcgaagaccaggtcttcgtctggcggcgcagctacgatgtgccg
ccgcccgtcatcgcccccgacgacccgaagcaccccgtccacgacccccgctacgccgat
gtgccccctgatgtccttccctgtggcgaaagccttgaagcgaccgtggcgcgggtactc
ccctactggtacgacgccatcgcccccgacctcatggcggggcgcgatgtgctggtggcg
gcccacggcaacagcctgcgcgcccttgtcatgcatcttgacgggcttgaccgcgaggat
gtttcacgcctcgacatccccaccgggctgccccgcctgtacgaactggatgccgcactg
cgccccgtgtcgtaccgctatctgggagacccggcagaggctgaggaacgggcacgcgcc
gtagccgcgcaggggcggctcgaaaagaactga

DBGET integrated database retrieval system