KEGG   Desulfovibrio vulgaris Hildenborough: DVU2969Help
Entry
DVU2969           CDS       T00171                                 

Definition
(RefSeq) acetoacetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
dvu00010  Glycolysis / Gluconeogenesis
dvu00620  Pyruvate metabolism
dvu00640  Propanoate metabolism
dvu00680  Methane metabolism
dvu01100  Metabolic pathways
dvu01110  Biosynthesis of secondary metabolites
dvu01120  Microbial metabolism in diverse environments
dvu01130  Biosynthesis of antibiotics
dvu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVU2969
   00620 Pyruvate metabolism
    DVU2969
   00640 Propanoate metabolism
    DVU2969
  Energy metabolism
   00680 Methane metabolism
    DVU2969
Enzymes [BR:dvu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DVU2969
Lipid biosynthesis proteins [BR:dvu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DVU2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 2796283
NCBI-ProteinID: YP_012180
UniProt: Q726Y7
Position
complement(3075266..3077251)
Genome map
AA seq 661 aa AA seqDB search
MSQERIESMMDEKRHFAPPADSRGRAHVSGEAAREALVRRAAEDPEGFWGERAAQLIDWF
KPWDTVLDADMNEPRIEWFKGGRLNVAHNCLDRHVAGNRRNKAAIIWQGEPEEDVRVLTY
QMLYDEVRRFAAVLRKMGVHKGDRVSLYMPMIPELAVAMLACARIGAVHSIVFAGFSAVS
LQNRIHDCEAKVVVTADAVLRAGRRIPLKVNVDEAVRQCPSVEKVVVVNRGSLEVTMEEG
RDLWWHEVMADRTLDVDRPCEEMDAEDMLFILYTSGSTGKPKGVVHTTGGYLTYAAHTTQ
WVFDVQDDDVYWCTADIGWITGHSYIVYGPLALGATSLMFEGVPSWPSPDRFWRIVEKFR
VNIFYTAPTVVRALMREGTDWTERHDLSSLRVLGSVGEPINPEAWMWYHTHIGKGRLPIV
DTWWQTETGGIMISGLPYATTLKPGSATQPLPGVDAAIVRPDGSPAGPNEGGHLVIRKPW
PGMLRGIFGSPERYRSTYFERFPGMYESGDGARTDTDGYFWIMGRLDDVINVSGHRMGTA
EVESALVAHPSVAEAAVVGMPHAVKGEAIYAYVTLGADAEETEELRAELRAWVRKEIGPI
ATPDVLQFAEGLPKTRSGKIMRRILRKIAAGATSEFGDTSTLADPGVVSDLIEGRLQLTG
R
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggaacgtatcgagagcatgatggatgagaagcgccacttcgcccctcccgct
gacagccggggcagggcacatgtgtccggcgaagccgcgcgagaggcgcttgtgcggcgt
gccgccgaagaccccgaaggcttctggggcgaacgtgcggcacagctcatcgactggttc
aagccgtgggataccgtgctggatgccgacatgaacgaaccgcgcatcgagtggttcaag
ggcggaaggctcaacgtggcccacaactgcctcgacaggcatgtggcaggaaaccggcgc
aacaaggccgccatcatctggcagggcgaacccgaagaggacgtgcgggtgctcacctac
cagatgctgtatgacgaggtgcgccgtttcgccgccgttctgcgcaagatgggcgtgcac
aagggcgaccgcgtctcgctgtacatgcccatgattcctgaactggctgtcgccatgctc
gcctgcgcgcgcatcggggctgtccattccatcgtctttgccggattctcggctgtgagc
cttcagaatcgcatccacgactgcgaggccaaggtcgtggtcaccgccgacgcggtgctg
cgtgccggacggcgcatccccctcaaggtgaacgtcgacgaggccgtgcgccagtgtccc
agcgtggagaaggtcgtcgtcgtcaaccgcgggagcctcgaagtgaccatggaggagggg
cgtgacctgtggtggcatgaggtcatggccgaccgcaccctcgacgtcgaccgcccctgc
gaggagatggatgcggaggacatgctgttcatcctctacaccagtggcagcaccggcaag
cccaagggcgtggtgcacaccacgggcggctatcttacctatgccgcgcacaccacgcag
tgggtcttcgacgtgcaggacgacgacgtgtactggtgcaccgccgacatcggctggatt
accgggcacagctacatcgtctacggcccgctggccctcggggcgacctcgctgatgttc
gagggtgtgccctcgtggccctcgcccgaccgtttctggcgcatcgtcgagaagttccgc
gtcaacatcttctacaccgcccccaccgtcgtccgcgcactcatgcgtgaaggcacggac
tggacggaacggcacgacctttcgtcgttgcgtgtcctcgggtcggtgggcgaacccatc
aaccccgaagcgtggatgtggtaccatacccacatcggcaagggacgcctgcccatcgtc
gacacatggtggcagacagagacgggtggcatcatgatttcgggcctgccctacgccacc
accctcaagcccggttcggcaacgcagccgctgcccggcgtcgatgccgccatcgtccgg
cccgacggcagccccgcagggcccaacgaaggcgggcatcttgtcatccgcaagccgtgg
ccgggcatgttgcgcggcatcttcggctcgcccgaacggtaccgctcgacatacttcgaa
cgctttcccggcatgtacgagtccggcgatggcgcacgcaccgatacggacggctatttc
tggatcatgggccgcctcgacgacgtcatcaacgtctcgggacaccgcatgggcacggcc
gaggtcgagtctgcgctggtcgcccatcccagcgtcgcggaagccgccgtcgtgggcatg
ccacacgccgtgaagggtgaggccatctacgcctacgtgactctcggcgccgatgcggaa
gagaccgaggagctccgcgccgagctgcgcgcatgggtgcgcaaggagataggccccatc
gccacgcccgatgtgctccagttcgcagaggggctccccaagacgcgtagcggcaagatc
atgcggcgcatcctgcgcaagatcgccgccggggccaccagcgagttcggggacacttct
actctcgccgaccccggggtcgtctccgacctcattgaaggtcgcctgcaacttaccgga
aggtag

DBGET integrated database retrieval system