KEGG   Desulfovibrio vulgaris Hildenborough: DVU3014Help
Entry
DVU3014           CDS       T00171                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DVU3014
Enzymes [BR:dvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DVU3014
Peptidases [BR:dvu01002]
 Cysteine Peptidases
  Family C44
   DVU3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3128580..3130673
Genome map
AA seq 697 aa AA seqDB search
MCGIAGIVSPGAPVASATLAAMTESLAHRGPDACGLFIRPSGAGSPHVGLGHRRLSILDL
SDAGAQPMQSEDGAFTLVFNGEIYNYPDLRRDLEAAGHIFRSTSDTEAILRGYMAWGEGV
VARLKGMFAFALWDERKRSLLLARDRFGKKPLHYAVTRQGTLLFASEPKALLAHPEFRPE
PDAASLLHFLRYDYVPAPRSIYAGAAKLPPSHLMVWRDGRLEVRRYASLAFSGATGDRGV
PLREAEAAVDALLDAAVQRRLASDVPLGVFLSGGLDSSTVLAYMTRHIPAHDIRTFAIGF
DEASYDESAHAEAMARHAGSHHTMMRLPAARMLDLLDMVWTTQDEPMADASIIPTLLLCR
FAREHITVALGGDGGDELFAGYDPVLADLPARCLDWLPPAALRLLQGIALRLPTGDANMS
LGFKVQRFLSGLGAREVAARHQTWLGAFDDEGARAMLHPDLRAATRDVSPLDALDMLREE
CRDASRFDAMLHFYQRFYMCGSILTKVDSASMAVSLEVRSPFLDQDLADYVNRLPREHKL
RGLTRKVLLRRLMRSRMPDALLKRPKKGFGLPLARWFRHELRPLVTAMLDPGRVAQGGLL
DPVTVERMVRDHLSGRRDHRKEIWSALCVEAWRERYLHHSRATASDTIEFGTTPHGDGHL
ITAQAVPARSSAAINDSTNDSPSWAASPSRHRCNDSI
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagcaggcatcgtctctcccggcgcacccgtggcctccgccacgctcgcc
gccatgacggagagtctcgcccatcgcgggcccgacgcctgcggcctcttcatccggcct
tccggggcgggtagcccccatgtgggactcgggcaccgccgcctgtccatcctcgacctc
tccgacgcgggcgcacagcccatgcagagtgaggacggggcgttcacgctggtcttcaac
ggcgagatatacaactaccccgacctgcgacgcgaccttgaagccgccgggcacatcttc
cgttcgacgtccgacaccgaagccatcctgcgcggctacatggcgtggggcgaaggtgtc
gtcgcacgtctcaagggcatgttcgccttcgccctgtgggacgaacgaaagcgcagcctg
ctgctggcccgcgaccgcttcggcaagaagcccctgcactacgccgtcacccggcagggc
acgctgctcttcgcctccgaacccaaggcacttctcgcgcaccccgaattccggcccgaa
cccgacgccgcatcgcttctccatttcctgcgctacgactatgtgcccgcaccgcgttcc
atctacgccggggccgccaagttgccgccttcgcatctcatggtgtggcgcgacggacgt
cttgaagtgcggcgttacgccagcctcgccttctccggcgcgaccggggaccgcggggtt
ccgctgcgcgaggccgaagccgccgtggacgcgcttctcgacgctgccgtacaaagacgc
ctcgccagcgacgtgcccctcggcgtcttcctctccggcggtctcgactcgtcaacggtg
cttgcctacatgacgcggcacatccccgcccacgacatccgcaccttcgccatcggcttc
gacgaagcaagctacgacgaatcggcccatgccgaggccatggcgcgccatgccgggtcg
caccacaccatgatgcgcctgcccgccgcgcggatgctcgacctgctggacatggtgtgg
accacgcaggacgaacccatggccgacgcctccatcatccccaccctgctgctgtgccgt
ttcgcgcgcgaacacatcaccgtggcgctggggggcgacggcggcgacgaactcttcgcg
ggctacgaccccgtgcttgccgacctgcccgcccgctgcctcgactggctgcccccggcg
gccctgcggctgctacagggcatcgcgctgcggctgcccacgggggacgccaacatgagc
ctcggcttcaaggttcagcgtttcctctccggtctcggggcacgcgaggtggctgcacgc
caccagacatggctgggggcgttcgacgacgagggggcacgtgccatgctgcaccccgac
ctgcgcgccgccacacgcgacgtctcgcccctcgacgcgctggacatgctgcgcgaggag
tgccgcgacgcctcacggttcgacgccatgctccacttctaccagcgcttctacatgtgc
ggttccattctcaccaaggtggacagcgcgagcatggcggtctcgctggaggtgcgctcg
cccttcctcgaccaggaccttgcggactacgtcaacaggcttccgcgtgagcacaagttg
cgcggtctcacccgcaaggtgctgctgcgcaggctcatgcgttcgcgcatgcccgatgcg
ctactcaaacgtccgaagaagggcttcggcctgccgctggcccggtggttccgccatgaa
ctgcggcccctcgtgaccgccatgctcgaccccggtcgcgtggcgcagggcggcctcctc
gaccccgtgaccgtggaacgcatggtacgcgaccacctttcgggacgccgcgaccaccgc
aaggagatctggtcggccctgtgcgtcgaggcatggcgcgaacgctacctgcatcacagc
cgcgccacggcatccgacacgatagaattcggcacgacgccccacggagacgggcacctc
atcacagcgcaagccgtccctgcacggtcttcggctgccatcaacgactccacgaacgac
agcccgtcatgggccgcgtccccttcgaggcacagatgcaacgactcaatctag

DBGET integrated database retrieval system