KEGG   Desulfovibrio vulgaris Hildenborough: DVU3134Help
Entry
DVU3134           CDS       T00171                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dvu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3281017..3282510
Genome map
AA seq 497 aa AA seqDB search
MSNYVLALDQGTTSSRAILFTREGDIKQISQKEFTQIYPQPGWVEHNANEIFDTQSWVMR
ECLQEAGIGAADVVAAGITNQRETTVVWDKATGAPVYNAIVWQDRRTAGFCDELKARGLA
DVFRKKTGLVLDAYFSGTKVRWILDNVPGARAKAEKGELLFGTIDTWLIWNLTKGKAHVT
DSSNASRTLMFNINTGAWDDELLGILDVPRSMLPRVTGSSEVVGDIHPEFLGKAIPIAGN
AGDQQAATYGNACLKPGMAKNTYGTGCFMLMNTGTEVRSSQNNLLSTVAWTTPSGRFYAL
EGSVFIAGAVVQWLRDGLGIIKAAPEVEQLALSVPDNGGVYLVPAFAGLGAPHWDQYARG
TMVGITRGATKAHIARAALESIALQTLDIMDCMQKDSGIKLAALRADGGATRNNLLMQFQ
ADVLGVPVERPKVTETTALGAAYLAGLATGFWKSEDEIATMWQLDRRFEPNMSDDKRQHL
VYEWQRAVERAKAWVEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactacgtcctcgccctcgaccagggcaccaccagctcccgcgccatcctcttc
acgcgcgaaggtgacatcaagcagatttcgcagaaggaattcacccagatttacccccag
ccgggctgggtggagcacaacgccaacgagatattcgacacccagtcgtgggtcatgcgc
gagtgcctgcaagaggccggcatcggtgccgcggacgtcgtggccgcgggcatcaccaac
cagcgtgagacgaccgtggtgtgggacaaggccaccggcgcccccgtctacaacgccatc
gtgtggcaagaccgccgcaccgcaggcttctgcgacgaactcaaggcccgcggcctcgcc
gacgtgttccgcaagaagaccggcctcgtgctcgatgcgtacttctccggcaccaaggtg
cgctggatactcgacaacgtgccgggagcccgcgccaaggccgaaaagggcgaattgctg
ttcggcaccatcgacacatggctcatctggaacctcaccaagggcaaggcgcacgtcacc
gactcgtccaacgccagccgtaccctcatgttcaacatcaacacgggcgcgtgggatgac
gagcttctgggcatcctcgacgttccgcgctccatgctgccccgcgtgaccggttcgtcc
gaggtcgtgggtgacatccacccagaattcctcggcaaggccattcccatcgccggcaat
gcgggcgaccagcaggccgccacctacggcaacgcctgcctcaagcccggcatggccaag
aacacctacggcaccggctgcttcatgctcatgaacaccggcaccgaagtccgttccagc
cagaacaacctgctgagcaccgtggcatggacgaccccctcgggacgtttctacgccctg
gaaggcagcgtgttcatcgcaggcgcagtggtacagtggctgcgtgacggtctcggcatc
atcaaggccgcccccgaagtggaacaactggccctgagcgtccccgacaacggcggcgtc
tacctcgtgcccgccttcgcgggactgggtgccccccactgggaccagtacgcccgtggc
accatggtcggcatcacccgcggcgcgacgaaggcccacatcgcacgtgccgcgctcgag
tccatcgccttgcagaccctcgacatcatggactgcatgcagaaggactcgggcatcaag
ctggccgcactgcgcgctgacggcggcgccacccgcaacaacctgctgatgcagttccag
gccgacgttctcggcgtgcccgtcgagcgtcccaaggtcactgagaccacggccctcggc
gcagcctacctcgcgggtctcgccaccggattctggaagagcgaagacgagatagccacc
atgtggcaactcgaccgccgcttcgagcccaacatgtccgacgacaagcgccagcacctc
gtctacgaatggcagcgtgccgtagaacgcgccaaggcgtgggtcgaggcatag

DBGET integrated database retrieval system