KEGG   Desulfovibrio vulgaris Hildenborough: DVU3210Help
Entry
DVU3210           CDS       T00171                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dvu  Desulfovibrio vulgaris Hildenborough
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DVU3210 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVU3210 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DVU3210 (thrC)
Enzymes [BR:dvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DVU3210 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3375314..3376726
Genome map
AA seq 470 aa AA seqDB search
MEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWRTLFDSRASTRCR
SLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAYKNDGQNPSASFK
DRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPIKSAVILPHGKVT
PQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRILGQESYAFEVAQ
WYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQSHHADPVYRYYSV
EDPRQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAFQVVQVTEQAIMD
SMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLKFSGFQDMYFTNG
FPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLAGK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgtctgcctcggatgcggggcacggcactccatagacgaactgctctacacc
tgcccctcgtgcggcggggtcttcctgcttgaagacctcgacttcgaccacctcgccgac
caccgtagcggcgacgactggcgcacgctcttcgactcccgggcatccacccggtgccgt
tcgctgcgcggcatcttccgcttctatgaattgatggcccccgtccttgaagaggacgac
atcatctatcttggcgaaggcaatacgccggtggtggatgcctcgcccgccctcgaaaga
agcgtcgggcagcgtttcgcctacaagaacgacggccagaaccccagtgcatcgttcaag
gacaggggcatggcctgcgccttcagctacctgcgcgcactggtacgcaagcacggctgg
gacgaggtgctcaccatctgcgcctccacgggtgacacgtccgccgcagcggccctgtac
gcctcgtatgtgggttcccccatcaagtcggcggtcatcctgccccacggcaaggtcacc
ccgcagcagctttcgcagcctcttggcagcggggccacggtgctcgagattcccggcgtg
ttcgacgactgcatgaaagtggtcgagcaccttgccgagaactaccgcgtcgccctgctc
aactccaagaacagctggcgcatcctcgggcaggagtcgtacgccttcgaagtggcccag
tggtacggctgggacatggcgggcaagtgcgtcttcgtgcccatcggcaacgcaggcaac
atcaccgctgtcatgtcgggctttctcaagatgcaccgtcttggcatcatcgacgccctt
ccgcgcgtcttcggggtgcagtcgcaccacgccgaccccgtctaccgctactacagcgtc
gaagaccccaggcagcgccactacgaacccgtcaccgtccagcccagcgtggcgcaggcg
gcaatgatcggaaaccccgtgtccttcccccgcgtgaggcacctcgccgaacggttcgag
gccctcggcggccccggtgccttccaggtggtgcaggtgacggaacaggccatcatggat
tccatgatccgcgccaaccgccatgggcacatcgcctgcacgcagggtggcgagtgcctt
gcgggacttctgcgcgccaaggaactgggtcttgtcgacaaggacgagacggcggtgctc
gacgccacggcacacagcctcaagttctcgggctttcaggacatgtacttcaccaatggt
tttccgcccgcctatggcgtcacgcccgacgccactctcggcaacgcgccctcgctggtg
ctgcacgatgaggacaaggtggcactggctgaaaagtacaccgtcgaagcggcccagcgc
atcgcggcgaagcttggactggctggcaagtag

DBGET integrated database retrieval system