KEGG   Drosophila willistoni: Dwil_GK10056Help
Entry
Dwil_GK10056      CDS       T01067                                 

Definition
GK10056 gene product from transcript GK10056-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dwi  Drosophila willistoni
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dwi04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgagacatcgctgcccatggatatgtgctcgaatttcgatgcagatgaaatt
cgtcgactgggtaaacgtttccgtaaactggatctggacaattcgggagcactgagcata
gatgagttcatgtcgctgccagagctgcagcagaatcctctagtccagcgggttatcgac
atcttcgatgcggatggcaatggtgaggttgatttcaaggaattcattcaaggtgtctca
cagtttagtgtacggggcgataaattgtccaagcttcgttttgcattccgcatctatgac
atggacaacgatggctacatttcgaatggtgaactctttcaggtgctcaaaatgatggtg
ggcaataatctgaaggatacacaattgcaacagattgtcgataagacaatttgttttgcc
gacaaagatgaagatggcaaaatctcattcgatgagttttgctcggttgtcggtaatacg
gatatacataagaaaatggttgtggatgtttaa

DBGET integrated database retrieval system