KEGG   Drosophila willistoni: Dwil_GK10086Help
Entry
Dwil_GK10086      CDS       T01067                                 

Definition
GK10086 gene product from transcript GK10086-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dwil_GK10086
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   Dwil_GK10086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 893 aa AA seqDB search
MYRLEDTNSGSGMDKNKQKLTAAYGSSAGAVDTTQGSGGGRQRHAPLYGRFVVEEELPPT
HRDVMHHHSSPSSSSEVRAMQARIPTHFRDPAIAPLRKLSVDLIKTYKHINEVYYAKKKR
RAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKA
YDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCL
VFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLC
NPKRSAIKIVDFGSSCQLGQRIYYYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHT
GEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQSHKTRKFFDKIVTDGSYVLKKNQNGRKYK
PPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQH
NFFKRTTDESTNTSGAGATANAGAGGSGAGGAGAGSGGGGGGGGSSGGAGGLGTGAGNSS
SSSGGVVSSSAAAAAAAAAAASCSTGSGGSGGVSNSGSVTGVGGGGGSTTAQQQQSMPLP
LALVGGSGADAPCHGLVLTNNNRRQMYSSSNNNNNNNINSNSYPHAMDCDPPLGGGLGGL
SKQQMPPPPVPPIASGPGVGMVGGAGGGGVGGGMNSRPNGRLRVPIILTRLPPPPSLGGY
TPKAPASLPLDLMQHHYGSMSAAAAAASHLMMTDSSVISASAAGGAGNPPVPSAGSGPPS
TSSSSYTSLLFPPTPSGSFYGQAPASLSDLPLPPLPLPLPMSMPLQLPPNHPTSMSTAAQ
RRNLGAAVATAAPTATVGSGTSGSSSTTGATSDASSSSPMVGVCVQQNPVVIH
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattggaggacacgaatagcggcagcggtatggataagaacaagcagaagttg
accgctgcctatgggtccagtgcgggagccgtagacacaacgcagggtagcggaggaggt
agacaacgtcatgcacccctctatggacggtttgtggtcgaagaggaactgccaccaacg
catcgtgatgttatgcatcatcactctagtccttcgtcttcgtcggaggtgcgagccatg
caggcccgtatacctacacattttcgtgatccggccatagcaccattgcgcaagctgagc
gtcgatctgataaagacctacaagcacataaatgaggtttactatgcgaaaaagaaacgt
cgtgcccaacagacccaaggcgatgatgattcgtccaataaaaaggaacgaaaattatat
aacgatggctatgatgatgataatcacgattatataatcaagaatggtgaaaagttttta
gatcgctatgaaattgattcgttaattggcaaaggcagttttggtcaggtagtaaaagcc
tacgatcatgaggagcaatgtcatgtagcgataaaaataattaaaaataagaaaccgttc
ctaaatcaggcgcaaatcgaggtaaagctgcttgagatgatgaatcgtgcggatgctgag
aataaatactatatcgtcaagctcaaacggcattttatgtggcgcaatcatttgtgtctg
gtattcgagctgctatcatacaacctatacgatctgctaaggaatactaatttccgcggc
gtctcgttgaacctcacgcgcaaatttgcgcagcaactgtgcacggcgctgctgttcctt
agcacgcccgaactgaacataatacactgtgatttgaagcccgagaacatcttgctatgc
aatccaaaacgctcggccattaagattgttgactttggcagctcatgtcagctgggacag
cgaatatattattatatacaatcgcgcttttatcgctcaccggaggtgctattgggcatt
caatatgatctggcaatcgatatgtggtcattgggatgcatactggtcgagatgcatacg
ggtgaacccctattctctggctgcaacgaagtcgatcaaatgaacaaaatcgtcgaggtg
ctaggcatgccacccaaatatctgctagatcaatcgcataagacgcgcaaatttttcgat
aaaattgtgacggatggctcctatgtgctgaagaagaaccaaaatggacgtaaatataag
ccgcccggatcacgaaaattgcacgatatactcggtgtcgaaacgggcggcccaggcgga
cggcgactcgacgagcccggccattctgtatcagattatttaaaattcaaggatctaata
ttacgcatgctggattttgatcccaaaacccgtgtcacaccatactatgccttgcaacac
aatttctttaagcgcaccactgacgaatcgacgaataccagtggcgctggcgcaacagca
aatgccggcgccggtggcagtggagctggtggtgctggagccggttctggcggtggcggt
ggtggcggcggcagcagcggtggagctggtggacttggcaccggagcgggtaacagcagt
agcagcagtggtggcgtcgtatcatctagtgcagcagctgccgcggctgcagcagcggcc
gccagttgttctacgggtagcggtggcagtggcggcgttagcaatagcggatcagtcaca
ggtgtaggaggaggaggtggatccacaacagcacagcaacagcaatcaatgccactgcca
ttggctttggtgggtggcagtggggcggacgcaccatgtcacggtctggtgctaacgaac
aacaatcgccgacaaatgtacagcagcagcaacaacaacaacaacaacaacatcaacagc
aatagctatccgcacgccatggactgcgacccgccactgggtggaggacttggaggactg
agcaaacaacaaatgccaccacctccagtgccaccaattgcctcaggccctggcgtggga
atggtgggtggagctggcggcggcggcgtcggcggtgggatgaattctcgaccaaatgga
cgcctacgtgtgcctatcatactgacacgattgccgccaccgcctagccttggtggctat
acacccaaagccccagcctcactgccattggatctaatgcagcatcattatggcagtatg
tcggcagctgcggctgctgcctcccatctaatgatgaccgattcgagtgtaataagcgct
tcggcagctggcggtgctggcaatccgcctgtgcccagcgccggatcgggtccaccctcc
acatcgtcatcgtcgtatacgtcgctgctgtttccgccgacaccatcgggctcgttttat
ggccaggcgcccgcctcgttaagcgatttgcctttgccgccactgccgctgccgctgccc
atgtcaatgccattgcaactgcccccgaatcatccaacgtccatgtcgactgccgcccag
cgtcgcaatttgggagccgctgtggcaacggcagcaccaacggccacagtgggttcgggt
acatccggcagcagttcgaccactggggccactagcgatgcctcatcgtcgtcgcccatg
gtgggcgtatgtgttcaacagaatcctgtagttatacactag

DBGET integrated database retrieval system